BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1318 (683 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X15217-1|CAA33287.1| 415|Homo sapiens protein ( Human sno oncog... 31 5.0 >X15217-1|CAA33287.1| 415|Homo sapiens protein ( Human sno oncogene mRNA for snoA protein, ski-related. ). Length = 415 Score = 30.7 bits (66), Expect = 5.0 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +2 Query: 491 KFNFNNNR*ATSKYTFLSKF*VTFIVLYYFYLQCFILNSITLFSIALLTLYERSLIY 661 KF+ + + SK +FL +F + +V + + C + N + +IA T + LIY Sbjct: 354 KFSMRSGKRNQSKASFLYQFLIMVMVYFEMKILCLVCNLTCMLNIAHATTTKYRLIY 410 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,039,468 Number of Sequences: 237096 Number of extensions: 1516227 Number of successful extensions: 1882 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -