BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1317 (316 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 2.0 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 4.7 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 2.0 Identities = 14/58 (24%), Positives = 18/58 (31%) Frame = -3 Query: 194 CVYCKSYGHTRDQCRTLLLKQTAXXXXXXXXXXXXNIKCYGCGASGVIRSNCSKCSSN 21 CV+C++ G R LLK C CG C K + N Sbjct: 40 CVFCRNNGEEEAYYRKHLLKDADGRVSCPVLRAYTCPICGACGDIAHTVKYCPKGTKN 97 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 20.6 bits (41), Expect = 4.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 316 PPRPASQRVPTAAVEVSPRQRRQAIT 239 PP+P ++ PT+ VS + AIT Sbjct: 250 PPKPQTKTKPTSPYHVS--DHKAAIT 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,276 Number of Sequences: 438 Number of extensions: 853 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6719922 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -