BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1316 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 26 0.98 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 4.0 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 26.2 bits (55), Expect = 0.98 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 423 WGWRDWFYFVARRVDSFFISF 361 W WR W+ F+ V FFI F Sbjct: 8 WWWRWWWDFILGLVAFFFIPF 28 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 582 VVTGSYRHLQHKCATHIVTTAAPALQTETHYC 677 + + SY L+ KC I+ A ++T H C Sbjct: 2413 IQSSSYIPLEGKCERDIILQLAVTIRTMVHNC 2444 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,901 Number of Sequences: 2352 Number of extensions: 12914 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -