BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1315 (436 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O13531 Cluster: Putative uncharacterized protein YLR202... 32 6.0 >UniRef50_O13531 Cluster: Putative uncharacterized protein YLR202C; n=1; Saccharomyces cerevisiae|Rep: Putative uncharacterized protein YLR202C - Saccharomyces cerevisiae (Baker's yeast) Length = 108 Score = 31.9 bits (69), Expect = 6.0 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +2 Query: 86 NLCFFYRXYNFFILYFGYSFXL-----NKKIAVELXALLXNQNGF 205 N+C FYR YNFF++ SF +KIA+ + + N GF Sbjct: 8 NICVFYRYYNFFLICHDISFPFRTILGGRKIAITI--VRNNNTGF 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 295,494,089 Number of Sequences: 1657284 Number of extensions: 3863849 Number of successful extensions: 7274 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7266 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 21496989549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -