BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1308 (561 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1137 - 26392399-26392613,26392828-26393233 29 1.9 02_02_0233 + 8105765-8107840 29 1.9 02_03_0026 - 14045653-14045874,14047023-14047215,14047518-140476... 27 7.7 >12_02_1137 - 26392399-26392613,26392828-26393233 Length = 206 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 8 RTESRTYRDTLETNNQISNGFLFHENIRVNLLKCCYVSCYSFSLQ 142 R R +N+ +S+G+ F ++ V L +CC + CY Q Sbjct: 32 RRSERVAGSRWSSNSGVSHGWTFVSDLEV-LTRCCMIDCYGGDAQ 75 >02_02_0233 + 8105765-8107840 Length = 691 Score = 29.5 bits (63), Expect = 1.9 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 368 WRRREIAQRCRTCVRLLLSGSDTAAISSVILKPRGRKRSSPARIEIASYSASSFGR 535 +RR I RTC+ L GSD AI + ++ +P + A +++ GR Sbjct: 37 FRRYRIPALFRTCIWLAYLGSDALAIYGLATLFNRHRKPAPGAVAAAGGTSNGHGR 92 >02_03_0026 - 14045653-14045874,14047023-14047215,14047518-14047618, 14050145-14050272,14050409-14050502,14050749-14051237, 14052622-14052915,14053602-14053732,14053829-14055440, 14055539-14055651,14055902-14056933,14057023-14057145, 14057250-14057688 Length = 1656 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 365 AWRRREIAQRCRTCVRLLLSGSDTAAISSVILKPRGRK 478 A++ E QR + CVR+ DTA+ S V + +G++ Sbjct: 1357 AYKAEETTQRVQGCVRIAEEMRDTASKSLVTIHQQGQQ 1394 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,914,213 Number of Sequences: 37544 Number of extensions: 264193 Number of successful extensions: 668 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -