BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1308 (561 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF145671-1|AAD38646.1| 800|Drosophila melanogaster BcDNA.GH1197... 45 8e-05 AE014296-3529|AAF51717.1| 800|Drosophila melanogaster CG6014-PA... 45 8e-05 AY071219-1|AAL48841.1| 378|Drosophila melanogaster RE26319p pro... 38 0.012 AE014297-2005|AAF55166.1| 378|Drosophila melanogaster CG14866-P... 38 0.012 BT023353-1|AAY55769.1| 130|Drosophila melanogaster IP02041p pro... 33 0.26 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 31 1.4 AJ973208-1|CAJ00357.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ973207-1|CAJ00356.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ973206-1|CAJ00355.1| 967|Drosophila melanogaster thiolester c... 30 1.9 AJ973205-1|CAJ00354.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ973204-1|CAJ00353.1| 967|Drosophila melanogaster thiolester c... 30 1.9 AJ973203-1|CAJ00352.1| 967|Drosophila melanogaster thiolester c... 30 1.9 AJ973202-1|CAJ00351.1| 967|Drosophila melanogaster thiolester c... 30 1.9 AJ973201-1|CAJ00350.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ973200-1|CAJ00349.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ973199-1|CAJ00348.1| 953|Drosophila melanogaster thiolester c... 30 1.9 AJ269538-1|CAB87807.1| 1354|Drosophila melanogaster TEP1 protein... 30 1.9 AE014134-2648|AAF53490.3| 1354|Drosophila melanogaster CG18096-P... 30 1.9 AJ973633-3|CAJ00623.1| 1375|Drosophila melanogaster thiolester c... 29 3.3 AY122084-1|AAM52596.1| 1420|Drosophila melanogaster GH01829p pro... 28 9.9 AY118302-1|AAM48331.1| 798|Drosophila melanogaster GH08432p pro... 28 9.9 AJ973634-5|CAJ00630.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973634-4|CAJ00629.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973634-3|CAJ00628.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973634-2|CAJ00627.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973634-1|CAJ00626.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973633-5|CAJ00625.1| 1386|Drosophila melanogaster thiolester c... 28 9.9 AJ973633-4|CAJ00624.1| 1366|Drosophila melanogaster thiolester c... 28 9.9 AJ973633-2|CAJ00622.1| 1377|Drosophila melanogaster thiolester c... 28 9.9 AJ973633-1|CAJ00621.1| 1398|Drosophila melanogaster thiolester c... 28 9.9 AJ973632-5|CAJ00620.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973632-4|CAJ00619.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973632-3|CAJ00618.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973632-2|CAJ00617.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973632-1|CAJ00616.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973631-5|CAJ00615.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973631-4|CAJ00614.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973631-3|CAJ00613.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973631-2|CAJ00612.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973631-1|CAJ00611.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973630-5|CAJ00610.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973630-4|CAJ00609.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973630-3|CAJ00608.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973630-2|CAJ00607.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973630-1|CAJ00606.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973629-5|CAJ00605.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973629-4|CAJ00604.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973629-3|CAJ00603.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973629-2|CAJ00602.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973629-1|CAJ00601.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973628-5|CAJ00600.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973628-4|CAJ00599.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973628-3|CAJ00598.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973628-2|CAJ00597.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973628-1|CAJ00596.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973627-5|CAJ00595.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973627-4|CAJ00594.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973627-3|CAJ00593.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973627-2|CAJ00592.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973627-1|CAJ00591.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973626-5|CAJ00590.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ973626-4|CAJ00589.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973626-3|CAJ00588.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973626-2|CAJ00587.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973626-1|CAJ00586.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973625-5|CAJ00585.1| 1387|Drosophila melanogaster thiolester c... 28 9.9 AJ973625-4|CAJ00584.1| 1367|Drosophila melanogaster thiolester c... 28 9.9 AJ973625-3|CAJ00583.1| 1376|Drosophila melanogaster thiolester c... 28 9.9 AJ973625-2|CAJ00582.1| 1378|Drosophila melanogaster thiolester c... 28 9.9 AJ973625-1|CAJ00581.1| 1399|Drosophila melanogaster thiolester c... 28 9.9 AJ269539-1|CAB87808.1| 1420|Drosophila melanogaster TEP2 protein... 28 9.9 AE014134-1316|AAN10640.1| 1408|Drosophila melanogaster CG7052-PD... 28 9.9 AE014134-1315|AAN10639.1| 1388|Drosophila melanogaster CG7052-PE... 28 9.9 AE014134-1314|AAF52540.2| 1397|Drosophila melanogaster CG7052-PC... 28 9.9 AE014134-1313|AAF52539.2| 1399|Drosophila melanogaster CG7052-PB... 28 9.9 AE014134-1312|AAF52541.2| 1420|Drosophila melanogaster CG7052-PA... 28 9.9 >AF145671-1|AAD38646.1| 800|Drosophila melanogaster BcDNA.GH11973 protein. Length = 800 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +1 Query: 352 SQCRGVEAQRNSTKMSYVCPPSFIRLGHSCYFFSDTEATWQKALFACKDRDSIL 513 SQ R ++ +CPP F R+G CY D ++W +A F CKD+++ L Sbjct: 45 SQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANL 98 >AE014296-3529|AAF51717.1| 800|Drosophila melanogaster CG6014-PA protein. Length = 800 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +1 Query: 352 SQCRGVEAQRNSTKMSYVCPPSFIRLGHSCYFFSDTEATWQKALFACKDRDSIL 513 SQ R ++ +CPP F R+G CY D ++W +A F CKD+++ L Sbjct: 45 SQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANL 98 >AY071219-1|AAL48841.1| 378|Drosophila melanogaster RE26319p protein. Length = 378 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 373 AQRNSTKMSYVCPPSFIRLGHSCYFF-SDTEATWQKALFACKDRDS-ILQCQLVWEDKNL 546 A N ++ CP +F R+ +CY+ S + W+ A ACK +S + + + V E++ + Sbjct: 183 AGNNQKEVKDPCPANFTRISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEI 242 Query: 547 XNYL 558 YL Sbjct: 243 MAYL 246 >AE014297-2005|AAF55166.1| 378|Drosophila melanogaster CG14866-PA protein. Length = 378 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 373 AQRNSTKMSYVCPPSFIRLGHSCYFF-SDTEATWQKALFACKDRDS-ILQCQLVWEDKNL 546 A N ++ CP +F R+ +CY+ S + W+ A ACK +S + + + V E++ + Sbjct: 183 AGNNQKEVKDPCPANFTRISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEI 242 Query: 547 XNYL 558 YL Sbjct: 243 MAYL 246 >BT023353-1|AAY55769.1| 130|Drosophila melanogaster IP02041p protein. Length = 130 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +1 Query: 406 CPPSFIRLGHSCYFFSDTEATWQKALFACKDRDSILQCQLVWEDKNL 546 CP F R+G+ CY S EA W A +C+ + L EDK L Sbjct: 27 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLL 73 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 406 CPPSFI--RLGHSCYFFSDTEATWQKALFACKDRDSILQC 519 CPPS + R+ H+C+ D E+ A+ +D ++ QC Sbjct: 1839 CPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQC 1878 >AJ973208-1|CAJ00357.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973207-1|CAJ00356.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973206-1|CAJ00355.1| 967|Drosophila melanogaster thiolester containing protein I protein. Length = 967 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973205-1|CAJ00354.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973204-1|CAJ00353.1| 967|Drosophila melanogaster thiolester containing protein I protein. Length = 967 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973203-1|CAJ00352.1| 967|Drosophila melanogaster thiolester containing protein I protein. Length = 967 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973202-1|CAJ00351.1| 967|Drosophila melanogaster thiolester containing protein I protein. Length = 967 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973201-1|CAJ00350.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973200-1|CAJ00349.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ973199-1|CAJ00348.1| 953|Drosophila melanogaster thiolester containing protein I protein. Length = 953 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 266 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 297 >AJ269538-1|CAB87807.1| 1354|Drosophila melanogaster TEP1 protein protein. Length = 1354 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 667 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 698 >AE014134-2648|AAF53490.3| 1354|Drosophila melanogaster CG18096-PA protein. Length = 1354 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P+ G+ R R R+ QP + NLPY Sbjct: 667 FSLSPQSGLAVTRNPSRIRVFQPFFITTNLPY 698 >AJ973633-3|CAJ00623.1| 1375|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1375 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/72 (30%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Frame = -3 Query: 496 PCRRRALSATWLQYH*RNSSCVRAG*KKADTRTTS--LCYFSAPPRLGIETRRQSVRWRL 323 P R+ W+ Y+ N KK TS + FS P GI + + R+ Sbjct: 638 PQIRKEFPENWIFYNAENVGEEFTLTKKIPDTITSWVVTGFSLNPTSGIALTKNPSKIRV 697 Query: 322 LQPIVFSRNLPY 287 QP S NLPY Sbjct: 698 FQPFFVSTNLPY 709 >AY122084-1|AAM52596.1| 1420|Drosophila melanogaster GH01829p protein. Length = 1420 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 723 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 754 >AY118302-1|AAM48331.1| 798|Drosophila melanogaster GH08432p protein. Length = 798 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 101 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 132 >AJ973634-5|CAJ00630.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973634-4|CAJ00629.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973634-3|CAJ00628.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973634-2|CAJ00627.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973634-1|CAJ00626.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973633-5|CAJ00625.1| 1386|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1386 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 689 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 720 >AJ973633-4|CAJ00624.1| 1366|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1366 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 669 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 700 >AJ973633-2|CAJ00622.1| 1377|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1377 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 680 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 711 >AJ973633-1|CAJ00621.1| 1398|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1398 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 701 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 732 >AJ973632-5|CAJ00620.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973632-4|CAJ00619.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973632-3|CAJ00618.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973632-2|CAJ00617.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973632-1|CAJ00616.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973631-5|CAJ00615.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973631-4|CAJ00614.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973631-3|CAJ00613.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973631-2|CAJ00612.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973631-1|CAJ00611.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973630-5|CAJ00610.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973630-4|CAJ00609.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973630-3|CAJ00608.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973630-2|CAJ00607.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973630-1|CAJ00606.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973629-5|CAJ00605.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973629-4|CAJ00604.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973629-3|CAJ00603.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973629-2|CAJ00602.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973629-1|CAJ00601.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973628-5|CAJ00600.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973628-4|CAJ00599.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973628-3|CAJ00598.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973628-2|CAJ00597.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973628-1|CAJ00596.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973627-5|CAJ00595.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973627-4|CAJ00594.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973627-3|CAJ00593.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973627-2|CAJ00592.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973627-1|CAJ00591.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973626-5|CAJ00590.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ973626-4|CAJ00589.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973626-3|CAJ00588.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973626-2|CAJ00587.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973626-1|CAJ00586.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973625-5|CAJ00585.1| 1387|Drosophila melanogaster thiolester containing proteinII, isoform D protein. Length = 1387 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 690 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 721 >AJ973625-4|CAJ00584.1| 1367|Drosophila melanogaster thiolester containing proteinII, isoform E protein. Length = 1367 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 670 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 701 >AJ973625-3|CAJ00583.1| 1376|Drosophila melanogaster thiolester containing proteinII, isoform C protein. Length = 1376 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 679 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 710 >AJ973625-2|CAJ00582.1| 1378|Drosophila melanogaster thiolester containing proteinII, isoform B protein. Length = 1378 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 681 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 712 >AJ973625-1|CAJ00581.1| 1399|Drosophila melanogaster thiolester containing proteinII, isoform A protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AJ269539-1|CAB87808.1| 1420|Drosophila melanogaster TEP2 protein protein. Length = 1420 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 723 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 754 >AE014134-1316|AAN10640.1| 1408|Drosophila melanogaster CG7052-PD, isoform D protein. Length = 1408 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 711 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 742 >AE014134-1315|AAN10639.1| 1388|Drosophila melanogaster CG7052-PE, isoform E protein. Length = 1388 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 691 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 722 >AE014134-1314|AAF52540.2| 1397|Drosophila melanogaster CG7052-PC, isoform C protein. Length = 1397 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 700 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 731 >AE014134-1313|AAF52539.2| 1399|Drosophila melanogaster CG7052-PB, isoform B protein. Length = 1399 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 702 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 733 >AE014134-1312|AAF52541.2| 1420|Drosophila melanogaster CG7052-PA, isoform A protein. Length = 1420 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 382 FSAPPRLGIETRRQSVRWRLLQPIVFSRNLPY 287 FS P GI + + R+ QP S NLPY Sbjct: 723 FSLNPTSGIALTKNPSKIRVFQPFFVSTNLPY 754 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,471,137 Number of Sequences: 53049 Number of extensions: 451381 Number of successful extensions: 1114 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -