BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1308 (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 2.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.9 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 277 HLTLQTDTTLSCSHSQFIFSLYNTNSVIKTFC 182 HL + TLS S+S ++ S+Y + + T C Sbjct: 363 HLHYRQPPTLSESYSSYVNSMYASGAQFATPC 394 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 20 RTYRDTLETNNQISNGFLFHENIRVNLLKCC 112 + YR + N+I LF N R+ L C Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFC 270 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 119 SCYSFSLQLTQVFQSSSFSY-NTKCLD 196 S YSF +L +F SSS + +T LD Sbjct: 477 SIYSFLERLNLIFMSSSLQWSSTHTLD 503 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 119 SCYSFSLQLTQVFQSSSFSY-NTKCLD 196 S YSF +L +F SSS + +T LD Sbjct: 515 SIYSFLERLNLIFMSSSLQWSSTHTLD 541 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,614 Number of Sequences: 438 Number of extensions: 2626 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -