BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1307 (527 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.10 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 3.0 SPAC4H3.08 |||short chain dehydrogenase |Schizosaccharomyces pom... 25 9.2 >SPBC428.10 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 751 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 377 RAAADQNAGETRVTTPXRYAQXAFXRIQP 463 + A+ N G TTP +AQ + RI+P Sbjct: 307 KTVANTNVGSKNGTTPRSFAQKSSKRIKP 335 >SPAC4H3.08 |||short chain dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 286 Score = 24.6 bits (51), Expect = 9.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 212 RLGSQVKRKQSYSFAYYKECQFFTGRVLHEEGSAV 316 R+G V+ Y F + + TG+ LH G V Sbjct: 249 RMGQPVEVASCYLFLACSDGGYMTGQTLHPNGGTV 283 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,804,439 Number of Sequences: 5004 Number of extensions: 30817 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -