BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1307 (527 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031621-3|CAA20935.2| 740|Caenorhabditis elegans Hypothetical ... 28 4.8 U55375-4|AAC69042.3| 287|Caenorhabditis elegans Lim domain fami... 27 8.3 >AL031621-3|CAA20935.2| 740|Caenorhabditis elegans Hypothetical protein F28H6.6 protein. Length = 740 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +1 Query: 13 SAARRTATHREAQLAATHGPCRAASGPRCLCSSRSSAPAPGHRRDSP 153 S AR T T + C A + C S+R + A G R+D P Sbjct: 12 STARTTVTKSTGNFRRSARHCSAPTLTYCPSSTRKKSSAAGTRKDDP 58 >U55375-4|AAC69042.3| 287|Caenorhabditis elegans Lim domain family protein 6 protein. Length = 287 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 197 MSFLRVSAMSRSEQQGLSRRCPGAGADDREEQRQRGPEAARHGPCVAASCASL 39 MS L +SA + S + + C G G ++ R E + H C+ SC L Sbjct: 1 MSLLLISATTSSTTE--DKLCSGCGCLIKDRYIYRVMEDSYHESCLRCSCCQL 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,593,696 Number of Sequences: 27780 Number of extensions: 198579 Number of successful extensions: 710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -