BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1302 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) 31 0.71 SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) 30 1.6 SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48) 27 8.8 >SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) Length = 667 Score = 31.1 bits (67), Expect = 0.71 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 259 IRDEHSG-VGMPSLLHEGDL*WPLSFHYGSRHFSTGVALVH 140 +R + SG V +PS +HE D PL F +GS + T + L H Sbjct: 199 VRTQASGPVPLPSSIHEADDMLPLCFEFGSLNSQTLLMLEH 239 >SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) Length = 365 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 398 TYEPNDDECLNPWRDDTEKEEL 463 TYE D+ C +PW+D ++K E+ Sbjct: 268 TYERLDNSCTSPWQDVSQKSEV 289 >SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 27.9 bits (59), Expect = 6.6 Identities = 22/81 (27%), Positives = 30/81 (37%), Gaps = 9/81 (11%) Frame = +2 Query: 386 IVNGTYEPNDDECLNPW--RDDTEKEELASGGTXXXXXXXXXXXXXXAI*PP-------M 538 I +G EP D+EC P D+ E EE I + Sbjct: 174 IASGGVEPTDEECRWPSDAEDEDEAEEKEEKEATEVSKLSGEVEEKVKIDDEEKIETEQL 233 Query: 539 DPNVKGIPDFWYNIFRNVSML 601 + KGIP+FW +NV +L Sbjct: 234 PEDTKGIPEFWLTAMKNVELL 254 >SB_18464| Best HMM Match : AFG1_ATPase (HMM E-Value=0.48) Length = 675 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 88 RHQNVRRYPYLIFHSHRRQNFPKRKMA 8 RHQ ++ + L++H +R NF +R A Sbjct: 217 RHQYIQEFGALVYHWRQRDNFCRRNNA 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,305,912 Number of Sequences: 59808 Number of extensions: 360571 Number of successful extensions: 828 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -