BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1300 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.0 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 6.2 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.2 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 402 SIRAHRPKGKVHSPASMNSP 343 ++R HR +G VH+ ++ SP Sbjct: 304 TLRIHRGRGSVHNGSNNGSP 323 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 466 HSTRPPCTSHPSRAPLYASGRTTGI 540 H PP H S APL A+ G+ Sbjct: 511 HHVAPPSGHHASSAPLLAATLAGGL 535 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +3 Query: 483 MYVASKPCSAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHSASGLSRSXP 641 +Y ++ ++ +++HR C P +L +I + P H + S S P Sbjct: 53 LYSGTRSSESLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +3 Query: 474 TPAMYVASKPCSAV 515 TP +YV+++P SA+ Sbjct: 99 TPTVYVSNEPSSAI 112 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 41 GMCKAGFAGD 70 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,043 Number of Sequences: 438 Number of extensions: 5498 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -