BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1299 (615 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 27 0.64 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 27 0.64 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 27 0.64 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 26 1.1 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 25 1.9 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 26.6 bits (56), Expect = 0.64 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 221 ATFKFSLFINIQPPYXSNHRTEVITLHHYYYY 316 AT+ + N N+ TE I L+ YYYY Sbjct: 206 ATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYY 237 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 26.6 bits (56), Expect = 0.64 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 221 ATFKFSLFINIQPPYXSNHRTEVITLHHYYYY 316 AT+ + N N+ TE I L+ YYYY Sbjct: 206 ATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYY 237 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 26.6 bits (56), Expect = 0.64 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 221 ATFKFSLFINIQPPYXSNHRTEVITLHHYYYY 316 AT+ + N N+ TE I L+ YYYY Sbjct: 206 ATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYY 237 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 221 ATFKFSLFINIQPPYXSNHRTEVITLHHYYYY 316 AT+ + N N+ TE I L+ YYYY Sbjct: 206 ATYPMDYYNNFYTEEYLNYYTEDIGLNAYYYY 237 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 233 FSLFINIQPPYXSNHRTEVITLHHYYYYKNERKIYL 340 ++L +I+P Y ++ TE H YY K E Y+ Sbjct: 167 YALATDIKPMYYPSYPTEANFQPHPYYPKYEPDAYI 202 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,047 Number of Sequences: 2352 Number of extensions: 12881 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -