BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1299 (615 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069788-1|AAL39933.1| 1458|Drosophila melanogaster SD02996p pro... 32 0.54 AE014298-2575|AAF48732.2| 1458|Drosophila melanogaster CG8557-PA... 32 0.54 AE014298-2574|AAO41695.1| 1740|Drosophila melanogaster CG8557-PB... 32 0.54 >AY069788-1|AAL39933.1| 1458|Drosophila melanogaster SD02996p protein. Length = 1458 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 170 PGHTNSERTLYQSLTKAATFKFSLFINIQPPYXSNHRTEVITLHHYYYYKNERK 331 P T + L +++ + + K LF+ P Y S H+TEV YY N+ K Sbjct: 680 PRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEV-RCGCYYSIANDTK 732 >AE014298-2575|AAF48732.2| 1458|Drosophila melanogaster CG8557-PA, isoform A protein. Length = 1458 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 170 PGHTNSERTLYQSLTKAATFKFSLFINIQPPYXSNHRTEVITLHHYYYYKNERK 331 P T + L +++ + + K LF+ P Y S H+TEV YY N+ K Sbjct: 680 PRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEV-RCGCYYSIANDTK 732 >AE014298-2574|AAO41695.1| 1740|Drosophila melanogaster CG8557-PB, isoform B protein. Length = 1740 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 170 PGHTNSERTLYQSLTKAATFKFSLFINIQPPYXSNHRTEVITLHHYYYYKNERK 331 P T + L +++ + + K LF+ P Y S H+TEV YY N+ K Sbjct: 962 PRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEV-RCGCYYSIANDTK 1014 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,097,810 Number of Sequences: 53049 Number of extensions: 524943 Number of successful extensions: 963 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2517878700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -