BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1296 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 9.3 AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 23 9.3 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.0 bits (47), Expect = 9.3 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +1 Query: 316 LVTAVATKANKLEIICTFYYSCTDCMVGRAHYFRLDNIAIGIFLIPWSKIHSLLEIVCKL 495 L+TA++ + I T SC GR YF L +G+F +P I SLL ++ L Sbjct: 106 LLTAISILFRLVSISLTVLLSCEYYRNGRTVYFAL--TLVGLF-VP-GIITSLLNLLMYL 161 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 23.0 bits (47), Expect = 9.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 418 DGNNVPYLPYSQYMNSKMYILFQV 347 D N+PY P+ + M M ++ V Sbjct: 136 DDGNIPYAPFLKKMMDNMVVIDHV 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,325 Number of Sequences: 2352 Number of extensions: 11816 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -