BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1296 (702 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U59431-1|AAB19187.1| 290|Homo sapiens truncated pancreatic poly... 32 1.7 D86519-1|BAA13103.1| 290|Homo sapiens Y6 encoding protein protein. 32 1.7 >U59431-1|AAB19187.1| 290|Homo sapiens truncated pancreatic polypeptide receptor PP2 protein. Length = 290 Score = 32.3 bits (70), Expect = 1.7 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +2 Query: 425 ILLSEFFLYLGLKYIVYLKSFAS*FKTNSKALNKLEANGQQNKKK*SNTYLI 580 + L ++F+ LG I YLK + N+K K E G+ N+ K NT LI Sbjct: 213 LFLLQYFVPLGFILICYLKIVICLRRRNAKVDKKKENEGRLNENKRINTMLI 264 >D86519-1|BAA13103.1| 290|Homo sapiens Y6 encoding protein protein. Length = 290 Score = 32.3 bits (70), Expect = 1.7 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +2 Query: 425 ILLSEFFLYLGLKYIVYLKSFAS*FKTNSKALNKLEANGQQNKKK*SNTYLI 580 + L ++F+ LG I YLK + N+K K E G+ N+ K NT LI Sbjct: 213 LFLLQYFVPLGFILICYLKIVICLRRRNAKVDKKKENEGRLNENKRINTMLI 264 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,700,824 Number of Sequences: 237096 Number of extensions: 1374720 Number of successful extensions: 1576 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1576 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -