BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1294 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subuni... 26 5.9 SPBC1734.07c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 25 7.8 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 25 7.8 >SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subunit Tim50 |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 632 EWKEKEEKSLAESFAGRSEAXKPTRI 555 +W EK++K + F GRS + +P ++ Sbjct: 354 DWNEKKKKGSSFLFGGRSVSEEPPKL 379 >SPBC1734.07c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 554 ECGWVXMLHSFRRTIQLDSFLPSPSTXGIGFGDR-HL 661 +CG+ LHS + T+ + +P P++ + +R HL Sbjct: 268 DCGYFLRLHSQKATLDYEHTVPFPTSSWLSAEERLHL 304 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 663 HK*RSPNPIPXVEGEGRKESS*IVRRKE*SXQTHPHSII 547 H+ RSP+P P + GR+ ++ +R K+ + H II Sbjct: 127 HRERSPSPPPQYDNHGRRLNTREIRYKK-KLEDERHRII 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,302,887 Number of Sequences: 5004 Number of extensions: 39171 Number of successful extensions: 86 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -