BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1292 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70270-4|CAA94225.1| 615|Caenorhabditis elegans Hypothetical pr... 27 8.6 AF003740-1|AAM15561.2| 488|Caenorhabditis elegans Hypothetical ... 27 8.6 >Z70270-4|CAA94225.1| 615|Caenorhabditis elegans Hypothetical protein C53D6.6 protein. Length = 615 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +2 Query: 218 GTKPSYLDKSTRNYEFKEISH--LEAFCL---PLSTLRKPGLKKDLS 343 GT+ +++ + ++E K I+ + CL PLSTL +PG++ L+ Sbjct: 89 GTEGDFINWTAEDFEEKRINDALINMICLDAMPLSTLERPGIQHFLN 135 >AF003740-1|AAM15561.2| 488|Caenorhabditis elegans Hypothetical protein C41D11.3 protein. Length = 488 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 425 QCVSRGLFCHVPSGFGMSSPPRCFPSAMTSP 333 QC G+ C V G + P CF T+P Sbjct: 313 QCAIDGIHCQVDGGEWPTQPCACFAETCTNP 343 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,106,642 Number of Sequences: 27780 Number of extensions: 350295 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -