BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1290 (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) 142 1e-34 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 138 3e-33 SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 3e-33 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 134 5e-32 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 99 2e-21 SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) 82 2e-16 SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 56 1e-08 SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 56 2e-08 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 55 3e-08 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 55 4e-08 SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) 54 5e-08 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 38 0.005 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 38 0.006 SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 36 0.014 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 36 0.014 SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) 32 0.23 SB_54925| Best HMM Match : MFS_1 (HMM E-Value=4.7e-27) 32 0.30 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.92 SB_46898| Best HMM Match : Amelogenin (HMM E-Value=4.2) 29 1.6 SB_50693| Best HMM Match : C2 (HMM E-Value=0) 29 2.8 SB_9489| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 >SB_17881| Best HMM Match : Tubulin (HMM E-Value=0) Length = 458 Score = 142 bits (345), Expect = 1e-34 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = +3 Query: 36 IYSSHK*NKMREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYY 215 +YSS KMREIVH QAGQCGNQIGAKFWE+ISDEHGIDPTG YHGDSDLQLERINVYY Sbjct: 205 VYSSKLLFKMREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYY 264 Query: 216 NEASGGKYVPRAI 254 NEA+GGKYVPRA+ Sbjct: 265 NEATGGKYVPRAV 277 Score = 99.5 bits (237), Expect = 1e-21 Identities = 47/67 (70%), Positives = 49/67 (73%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHSRRVLSSSIQF*TSFERKR 433 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH ++ Sbjct: 278 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEA 337 Query: 434 ESCDLLQ 454 ESCD LQ Sbjct: 338 ESCDCLQ 344 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 138 bits (333), Expect = 3e-33 Identities = 60/64 (93%), Positives = 62/64 (96%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEASGGKYV 242 MREIVH QAGQCGNQIGAKFWE+ISDEHGIDPTG YHGDSDLQLERINVYYNEA+GGKYV Sbjct: 1 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV 60 Query: 243 PRAI 254 PRAI Sbjct: 61 PRAI 64 Score = 99.5 bits (237), Expect = 1e-21 Identities = 47/67 (70%), Positives = 49/67 (73%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHSRRVLSSSIQF*TSFERKR 433 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH ++ Sbjct: 65 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEA 124 Query: 434 ESCDLLQ 454 ESCD LQ Sbjct: 125 ESCDCLQ 131 >SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 138 bits (333), Expect = 3e-33 Identities = 60/64 (93%), Positives = 62/64 (96%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEASGGKYV 242 MREIVH QAGQCGNQIGAKFWE+ISDEHGIDPTG YHGDSDLQLERINVYYNEA+GGKYV Sbjct: 1 MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV 60 Query: 243 PRAI 254 PRAI Sbjct: 61 PRAI 64 Score = 64.1 bits (149), Expect = 6e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVF 337 LVDLEPGTMDSVRSGPFGQIFRPDNFVF Sbjct: 65 LVDLEPGTMDSVRSGPFGQIFRPDNFVF 92 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 134 bits (323), Expect = 5e-32 Identities = 57/64 (89%), Positives = 62/64 (96%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLERINVYYNEASGGKYV 242 MREIV +QAGQCGNQIGAKFWE+ISDEHGIDPTG YHGDSDLQLERINVYYNEA+GGKYV Sbjct: 1 MREIVSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV 60 Query: 243 PRAI 254 PR++ Sbjct: 61 PRSV 64 Score = 98.7 bits (235), Expect = 2e-21 Identities = 45/67 (67%), Positives = 49/67 (73%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHSRRVLSSSIQF*TSFERKR 433 L+DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH ++ Sbjct: 65 LIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELMDSVLDVVRKEA 124 Query: 434 ESCDLLQ 454 ESCD +Q Sbjct: 125 ESCDCIQ 131 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 98.7 bits (235), Expect = 2e-21 Identities = 46/67 (68%), Positives = 49/67 (73%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHSRRVLSSSIQF*TSFERKR 433 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH ++ Sbjct: 10 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEA 69 Query: 434 ESCDLLQ 454 ESCD +Q Sbjct: 70 ESCDCIQ 76 >SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27) Length = 144 Score = 82.2 bits (194), Expect = 2e-16 Identities = 37/69 (53%), Positives = 44/69 (63%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHSRRVLSSSIQF*TSFERKR 433 LVDLEPGTMD+VR GP G +FRPDNFV QSGA NNWAKGH ++ Sbjct: 21 LVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELIDNIFDVLRKEA 80 Query: 434 ESCDLLQXI 460 E+CD +Q + Sbjct: 81 ENCDCMQGV 89 >SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 59.7 bits (138), Expect = 1e-09 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQ--LERINVYYNEASGGK 236 MRE + + GQ G QIG WE+ EHGI P G D + + N +++E GGK Sbjct: 1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIDGGDDSFNTFFSETGGGK 60 Query: 237 YVPRAISSTWSPA 275 +VPRA+ P+ Sbjct: 61 HVPRAVFVDLEPS 73 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 56.4 bits (130), Expect = 1e-08 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGK 236 MRE + I GQ G QIG WE+ EHGI P G D + + N +++E GK Sbjct: 1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 60 Query: 237 YVPRAI 254 +VPRA+ Sbjct: 61 HVPRAV 66 Score = 54.4 bits (125), Expect = 5e-08 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + I GQ G QIG WE+ EHGI P G D + + N +++E GK+ Sbjct: 435 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 494 Query: 240 VPRAI 254 VPRA+ Sbjct: 495 VPRAV 499 Score = 50.4 bits (115), Expect = 8e-07 Identities = 20/40 (50%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ V G+ A NN+A+GH Sbjct: 68 VDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGH 107 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 501 VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 540 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 56.0 bits (129), Expect = 2e-08 Identities = 30/78 (38%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGK 236 MRE + I GQ G QIG WE+ EHGI P G D + N +++E GK Sbjct: 1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTQGGGDDSFNTFFSETGAGK 60 Query: 237 YVPRAISSTWSPAPWTLS 290 +VPRA+ P LS Sbjct: 61 HVPRAVFVDLEPTVVALS 78 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 55.2 bits (127), Expect = 3e-08 Identities = 26/72 (36%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGK 236 MRE + + GQ G Q+G WE+ EHGI P G D + + N +++E GK Sbjct: 1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGSGK 60 Query: 237 YVPRAISSTWSP 272 +VPRA+ P Sbjct: 61 HVPRAVFCDLEP 72 Score = 48.4 bits (110), Expect = 3e-06 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 260 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 DLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 69 DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 55.2 bits (127), Expect = 3e-08 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGK 236 MRE + I GQ G Q+G WE+ EHGI P G D + + N +++E GK Sbjct: 1 MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 60 Query: 237 YVPRAI 254 +VPRA+ Sbjct: 61 HVPRAV 66 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 68 VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 54.8 bits (126), Expect = 4e-08 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGK 236 +RE + I GQ G QIG WE+ EHGI P G D + + N +++E GK Sbjct: 586 VRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK 645 Query: 237 YVPRAI 254 +VPRA+ Sbjct: 646 HVPRAV 651 Score = 54.4 bits (125), Expect = 5e-08 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + I GQ G QIG WE+ EHGI P G D + + N +++E GK+ Sbjct: 514 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 573 Query: 240 VPRAI 254 VPRA+ Sbjct: 574 VPRAV 578 Score = 54.0 bits (124), Expect = 7e-08 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + + GQ G QIG WE+ EHGI P G D + + N +++E GK+ Sbjct: 66 RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 125 Query: 240 VPRAI 254 VPRA+ Sbjct: 126 VPRAV 130 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 132 VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 171 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 653 VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 692 >SB_34400| Best HMM Match : Tubulin (HMM E-Value=0) Length = 380 Score = 54.4 bits (125), Expect = 5e-08 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + I GQ G QIG WE+ EHGI P G D + + N +++E GK+ Sbjct: 1 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 60 Query: 240 VPRAI 254 VPRA+ Sbjct: 61 VPRAV 65 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 67 VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 106 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 54.0 bits (124), Expect = 7e-08 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + + GQ G Q+G WE+ EHGI P G D + + N +++E GK+ Sbjct: 806 RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 865 Query: 240 VPRAISSTWSP 272 VPRA+ + P Sbjct: 866 VPRAVFADLEP 876 Score = 53.2 bits (122), Expect = 1e-07 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE + I GQ G QIG WE+ EHGI P G D + + N ++ E GK+ Sbjct: 373 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFAETGAGKH 432 Query: 240 VPRAI 254 VPRA+ Sbjct: 433 VPRAV 437 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 439 VDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 478 Score = 48.4 bits (110), Expect = 3e-06 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 260 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 DLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 873 DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 911 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 54.0 bits (124), Expect = 7e-08 Identities = 27/72 (37%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = +3 Query: 66 REIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDL--QLERINVYYNEASGGKY 239 RE V I GQ G Q+G WE+ EHGI P G D + + N +++E GK+ Sbjct: 420 RECVSIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 479 Query: 240 VPRAISSTWSPA 275 VPRA+ P+ Sbjct: 480 VPRAVFVDLEPS 491 Score = 50.4 bits (115), Expect = 8e-07 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D +R+G + Q+F P+ + G+ A NN+A+GH Sbjct: 486 VDLEPSVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGH 525 Score = 48.4 bits (110), Expect = 3e-06 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 260 DLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 DLEP +D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 54 DLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 108 IGAKFWEIISDEHGIDPTGAYHGDSDLQL--ERINVYYNEASGGKYVPRAISSTWSP 272 +G WE+ EHGI P G D + + N +++E GK+VPRA+ P Sbjct: 1 MGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFCDLEP 57 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 48.8 bits (111), Expect = 2e-06 Identities = 18/40 (45%), Positives = 28/40 (70%) Frame = +2 Query: 257 VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VDLEP +D +R+G + Q+F P+ + G+ A NN+A+GH Sbjct: 33 VDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYARGH 72 >SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1383 Score = 47.6 bits (108), Expect = 6e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +2 Query: 254 LVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 LVDLEP +D VR+G + ++ P+ + G+ A NN+A+GH Sbjct: 978 LVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGH 1018 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = +3 Query: 63 MREIVHIQAGQCGNQIGAKFWEIISDEHGIDPTGAYHGDSDLQLER----INVYYNEASG 230 MRE + I GQ G QIG WE+ EHGI P G H SD +R + +++E + Sbjct: 196 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDG--HMPSDQSADRCDDSFSTFFSETAS 253 Query: 231 GKY 239 GK+ Sbjct: 254 GKH 256 >SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 44.8 bits (101), Expect = 4e-05 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +3 Query: 120 FWEIISDEHGIDPTGAYHG-DSDLQLERINVYYNE 221 FWE+I++EHGIDP G S +Q +R+NVY++E Sbjct: 1 FWEVIAEEHGIDPDGQCTAVQSKIQTDRLNVYFDE 35 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 281 DSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 D VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 13 DEVRTGTYRQLFHPEQLITGKEDAANNYARGH 44 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 37.9 bits (84), Expect = 0.005 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 230 RQVRAPRHLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW 364 + ++A L+D+E G ++++ GP +F + SG GNNW Sbjct: 71 KSLKARAVLIDMEEGVVNNILKGPLHDVFDCQQLITDVSGCGNNW 115 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 37.5 bits (83), Expect = 0.006 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 287 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 3 VRTGTYRQLFHPEQLITGKEDAANNYARGH 32 >SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 37.5 bits (83), Expect = 0.006 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 287 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VR+G + Q+F P+ + G+ A NN+A+GH Sbjct: 3 VRTGTYRQLFHPEQLITGKEDAANNYARGH 32 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 36.3 bits (80), Expect = 0.014 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 287 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 VR G + +F PD + G+ A NN+A+GH Sbjct: 3 VRMGTYRDLFHPDQLITGKEDAANNYARGH 32 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 36.3 bits (80), Expect = 0.014 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 287 VRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 376 +R+G + Q+F P+ + G+ A NN+A+GH Sbjct: 3 IRTGTYRQLFHPEQLLSGKEDAANNYARGH 32 >SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) Length = 474 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 72 IVHIQAGQCGNQIGAKFWEIISDE 143 IV +Q GQCGNQIG + +++I ++ Sbjct: 3 IVTLQLGQCGNQIGRELFDLIVED 26 Score = 30.7 bits (66), Expect = 0.70 Identities = 22/61 (36%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +2 Query: 320 PDNFVFGQS-GAGNNWAKGHSRRVLSSSIQF*TSFERKRESCDLLQXIPTDTLARAAAPG 496 P F Q G+GNNWA G S S + +R+ E CD L T L+ A G Sbjct: 94 PKGQQFSQKRGSGNNWAHGFSEHGPKSIDKVLDLVQREVEKCDRLDGFLT-LLSLAGGTG 152 Query: 497 S 499 S Sbjct: 153 S 153 >SB_54925| Best HMM Match : MFS_1 (HMM E-Value=4.7e-27) Length = 1373 Score = 31.9 bits (69), Expect = 0.30 Identities = 29/114 (25%), Positives = 47/114 (41%) Frame = -1 Query: 496 TGCRRPSECVSWNPLEQITRFPLPFERRLKLNRRAQHPP*VSLGPVVAGAGLSEDEVVRT 317 T RR S + P+E+ T+ LP RR + PP VS V A G+ ++ Sbjct: 959 TKSRRRSGIIKAKPVEEFTKLKLPSRRRETKVLHLKTPPPVSPVKVQASTGMIPPPFIK- 1017 Query: 316 EDLSERSRADRVHGAGLQVDEMARGTYLPPEASL*YTLMRSNCKSESPW*APVG 155 + + + + L D+ T L P+ L + + S K++ A VG Sbjct: 1018 GSIIQLTSGELKRVEDLTTDDFVHSTGLCPDLKLETSTVVSVRKNDEVGMALVG 1071 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.3 bits (65), Expect = 0.92 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -1 Query: 499 GTGCRRPSECV--SWNPLEQITRFPLPFERRLKLN-RRAQH 386 G GC R + SWNPL++ PLP + LK++ +A H Sbjct: 22 GVGCSRQQDGGHGSWNPLKECVTTPLPKQLALKMDGAQASH 62 >SB_46898| Best HMM Match : Amelogenin (HMM E-Value=4.2) Length = 210 Score = 29.5 bits (63), Expect = 1.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP K+ +CP Sbjct: 18 CPLKEMLDTPLCPLKKMLNTPLCP 41 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L AP CP ++ +CP Sbjct: 172 CPLKEMLDAPLCPLKEMLDTPLCP 195 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 62 CPLKEMLDTPLCPLKEMLNTPLCP 85 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 51 CPLKEMLDTPLCPLKEMLDTPLCP 74 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 73 CPLKEMLNTPLCPLKEMLNTPLCP 96 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 128 CPLKEMLNTPLCPLKEMLNTPLCP 151 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 139 CPLKEMLNTPLCPLKEMLNTPLCP 162 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 150 CPLKEMLNTPLCPLKEMLNTPLCP 173 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 7 CPLKEMLNTPLCPLKEMLDTPLCP 30 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 29 CPLKKMLNTPLCPLKEMLNTPLCP 52 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 40 CPLKEMLNTPLCPLKEMLDTPLCP 63 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 375 CPLAQLLPAPDCPKTKLSGRKICP 304 CPL ++L P CP ++ +CP Sbjct: 161 CPLKEMLNTPLCPLKEMLDAPLCP 184 >SB_50693| Best HMM Match : C2 (HMM E-Value=0) Length = 1049 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 351 APDCPKTKLSGRKICPKGPERTESMVPGSKST 256 A DCP ++ +GR +CP P +S + +K++ Sbjct: 138 AVDCPTSRKNGRGLCPFPPPPLQSALKRAKAS 169 >SB_9489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 218 IVVYIDALQLQVRVPM-VGTGGVDAVLVGDDLPEL 117 I VY DA++LQV P+ G+D + V D EL Sbjct: 48 ITVYADAVELQVTYPLRAPLRGIDLITVYADAVEL 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,697,441 Number of Sequences: 59808 Number of extensions: 319159 Number of successful extensions: 866 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -