BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1286 (464 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 27 5.8 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 27 5.8 SB_36642| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 4 RYRPVAD*HEGRHAKRAQEWQRDAQPSRTQQPVILDIINSSRHI 135 ++R + D +G + KR + + Q SR Q VIL +I +RH+ Sbjct: 352 KHRALDDGDDGAYHKRIRALIENLQYSRKHQFVILSVILIARHV 395 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 376 PPATPDPPGDRGGAELEPP 320 PP P PPG GGA PP Sbjct: 197 PPPPPPPPGFPGGAPPPPP 215 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 376 PPATPDPPGDRGGAELEPP 320 PP P PPGD GGA PP Sbjct: 318 PPPPPPPPGD-GGAPPPPP 335 >SB_36642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 37 RHAKRAQEWQRDAQPSRTQQPVILDIINSSRHISKKR 147 + AKR W A P++ +QP DI +H++ ++ Sbjct: 199 KDAKRFDTWSEKATPNQAKQPSDEDINRILKHVNIRK 235 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,999,406 Number of Sequences: 59808 Number of extensions: 226835 Number of successful extensions: 844 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 957531822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -