Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1286
         (464 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.    27   0.32 
Z49813-1|CAA89967.1|  247|Anopheles gambiae serine proteinase pr...    23   6.9  

>AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.
          Length = 156

 Score = 27.1 bits (57), Expect = 0.32
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +2

Query: 323 RLKLSPASVSWGIWCGRWRSVTGRRQSRQH 412
           R   +PA +S+ I   RW +V  +R  RQH
Sbjct: 39  RTNQNPALLSFAILFLRWHNVVAKRVRRQH 68


>Z49813-1|CAA89967.1|  247|Anopheles gambiae serine proteinase
           protein.
          Length = 247

 Score = 22.6 bits (46), Expect = 6.9
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 347 VSWGIWCGR 373
           VSWG+ CGR
Sbjct: 210 VSWGVGCGR 218


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 415,667
Number of Sequences: 2352
Number of extensions: 7054
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 40395045
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)