BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1286 (464 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY597812-1|AAT09005.1| 238|Homo sapiens UHS KerB-like protein. 31 2.6 AJ628246-1|CAF31638.1| 167|Homo sapiens keratin associated prot... 31 2.6 AB126072-1|BAD20199.1| 238|Homo sapiens keratin associated prot... 31 2.6 U73167-3|AAC02729.1| 417|Homo sapiens WUGSC:H_LUCA14.2 protein. 30 4.5 BC012892-1|AAH12892.1| 417|Homo sapiens hyaluronoglucosaminidas... 30 4.5 BC012368-1|AAH12368.1| 493|Homo sapiens angiopoietin-like 2 pro... 30 4.5 BC005896-1|AAH05896.1| 417|Homo sapiens hyaluronoglucosaminidas... 30 4.5 AY358274-1|AAQ88641.1| 493|Homo sapiens NL1 protein. 30 4.5 AL356862-8|CAI39725.1| 493|Homo sapiens angiopoietin-like 2 pro... 30 4.5 AF502912-1|AAM60778.1| 417|Homo sapiens hyaluronidase 3 protein. 30 4.5 AF502909-1|AAM60775.1| 387|Homo sapiens hyaluronidase 3 variant... 30 4.5 AF125175-1|AAD55357.1| 493|Homo sapiens angiopoietin-related pr... 30 4.5 AF040710-1|AAC70915.1| 463|Homo sapiens hyaluronidase protein. 30 4.5 AF036035-1|AAD04257.1| 417|Homo sapiens hyaluronidase 3 protein. 30 4.5 AF369794-1|AAK50059.2| 977|Homo sapiens B cell crosslinked IgM-... 29 6.0 X63755-1|CAA45283.1| 169|Homo sapiens high-sulpher keratin prot... 29 7.9 X55293-1|CAA39005.1| 169|Homo sapiens ultra high-sulphur kerati... 29 7.9 BC101744-1|AAI01745.2| 169|Homo sapiens keratin associated prot... 29 7.9 BC069531-1|AAH69531.1| 169|Homo sapiens keratin associated prot... 29 7.9 AJ006693-1|CAA07189.1| 169|Homo sapiens ultra high sulfer kerat... 29 7.9 AB126078-1|BAD20205.1| 169|Homo sapiens keratin associated prot... 29 7.9 AB126073-1|BAD20200.1| 288|Homo sapiens keratin associated prot... 29 7.9 >AY597812-1|AAT09005.1| 238|Homo sapiens UHS KerB-like protein. Length = 238 Score = 30.7 bits (66), Expect = 2.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C C+PSC Sbjct: 135 CCCSSGCGSSC--CQSSCCKPSC 155 >AJ628246-1|CAF31638.1| 167|Homo sapiens keratin associated protein 5-9 protein. Length = 167 Score = 30.7 bits (66), Expect = 2.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C C+PSC Sbjct: 64 CCCSSGCGSSC--CQSSCCKPSC 84 >AB126072-1|BAD20199.1| 238|Homo sapiens keratin associated protein protein. Length = 238 Score = 30.7 bits (66), Expect = 2.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C C+PSC Sbjct: 135 CCCSSGCGSSC--CQSSCCKPSC 155 >U73167-3|AAC02729.1| 417|Homo sapiens WUGSC:H_LUCA14.2 protein. Length = 417 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >BC012892-1|AAH12892.1| 417|Homo sapiens hyaluronoglucosaminidase 3 protein. Length = 417 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >BC012368-1|AAH12368.1| 493|Homo sapiens angiopoietin-like 2 protein. Length = 493 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 382 CHRAPAVTPARQPPPA*DTAPPYHHRP 462 C R P+ P QPPPA APP ++P Sbjct: 204 CQRVPSARPVPQPPPA---APPRVYQP 227 >BC005896-1|AAH05896.1| 417|Homo sapiens hyaluronoglucosaminidase 3 protein. Length = 417 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >AY358274-1|AAQ88641.1| 493|Homo sapiens NL1 protein. Length = 493 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 382 CHRAPAVTPARQPPPA*DTAPPYHHRP 462 C R P+ P QPPPA APP ++P Sbjct: 204 CQRVPSARPVPQPPPA---APPRVYQP 227 >AL356862-8|CAI39725.1| 493|Homo sapiens angiopoietin-like 2 protein. Length = 493 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 382 CHRAPAVTPARQPPPA*DTAPPYHHRP 462 C R P+ P QPPPA APP ++P Sbjct: 204 CQRVPSARPVPQPPPA---APPRVYQP 227 >AF502912-1|AAM60778.1| 417|Homo sapiens hyaluronidase 3 protein. Length = 417 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >AF502909-1|AAM60775.1| 387|Homo sapiens hyaluronidase 3 variant 1 protein. Length = 387 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >AF125175-1|AAD55357.1| 493|Homo sapiens angiopoietin-related protein-2 protein. Length = 493 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 382 CHRAPAVTPARQPPPA*DTAPPYHHRP 462 C R P+ P QPPPA APP ++P Sbjct: 204 CQRVPSARPVPQPPPA---APPRVYQP 227 >AF040710-1|AAC70915.1| 463|Homo sapiens hyaluronidase protein. Length = 463 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >AF036035-1|AAD04257.1| 417|Homo sapiens hyaluronidase 3 protein. Length = 417 Score = 29.9 bits (64), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 338 PASVSWGIWCGRWRSVTGRRQSRQHAS 418 PA + W WC W GRR++ Q AS Sbjct: 123 PAVLDWEEWCPLWAGNWGRRRAYQAAS 149 >AF369794-1|AAK50059.2| 977|Homo sapiens B cell crosslinked IgM-activating sequence protein protein. Length = 977 Score = 29.5 bits (63), Expect = 6.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 367 WPVALCHRAPAVTPARQPPPA*DTAPPYHHRP 462 W R PA PAR PP + P YH+ P Sbjct: 872 WLSRKAGRKPASDPARSPPDSDSQEPTYHNVP 903 >X63755-1|CAA45283.1| 169|Homo sapiens high-sulpher keratin protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >X55293-1|CAA39005.1| 169|Homo sapiens ultra high-sulphur keratin protein protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >BC101744-1|AAI01745.2| 169|Homo sapiens keratin associated protein 5-9 protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >BC069531-1|AAH69531.1| 169|Homo sapiens keratin associated protein 5-9 protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >AJ006693-1|CAA07189.1| 169|Homo sapiens ultra high sulfer keratin protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >AB126078-1|BAD20205.1| 169|Homo sapiens keratin associated protein protein. Length = 169 Score = 29.1 bits (62), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC 27 CC GC S C C+ C+P C Sbjct: 86 CCCSSGCGSSCCQCS--CCKPYC 106 >AB126073-1|BAD20200.1| 288|Homo sapiens keratin associated protein protein. Length = 288 Score = 29.1 bits (62), Expect = 7.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 95 CCVRDGCASRCHSCARFACRPSC*SA 18 CC GC S C C C+P C S+ Sbjct: 205 CCCSSGCGSSC--CQSSCCKPCCSSS 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,377,426 Number of Sequences: 237096 Number of extensions: 1133272 Number of successful extensions: 6218 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 4446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6173 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3986009860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -