Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1284
         (345 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    21   2.7  
EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive pep...    20   6.2  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 2.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = -1

Query: 315 NYHRKLIRQTFERXXRRYLXSDLQKLSRFI 226
           N H + +RQ FE+  +  +  +L+K S FI
Sbjct: 469 NEHLEHLRQVFEKLKQARMTINLEK-SNFI 497


>EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive
           peptide receptor 1 protein.
          Length = 374

 Score = 20.2 bits (40), Expect = 6.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +1

Query: 241 LLQIAGQVPAT 273
           LLQ+ GQ+P T
Sbjct: 272 LLQVFGQIPGT 282


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,464
Number of Sequences: 336
Number of extensions: 948
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  6770240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)