BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1284 (345 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 2.7 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 20 6.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 2.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 315 NYHRKLIRQTFERXXRRYLXSDLQKLSRFI 226 N H + +RQ FE+ + + +L+K S FI Sbjct: 469 NEHLEHLRQVFEKLKQARMTINLEK-SNFI 497 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 20.2 bits (40), Expect = 6.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 241 LLQIAGQVPAT 273 LLQ+ GQ+P T Sbjct: 272 LLQVFGQIPGT 282 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,464 Number of Sequences: 336 Number of extensions: 948 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6770240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -