BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--1284
(345 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 2.7
EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 20 6.2
>U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse
transcriptase andRNase H protein.
Length = 712
Score = 21.4 bits (43), Expect = 2.7
Identities = 11/30 (36%), Positives = 18/30 (60%)
Frame = -1
Query: 315 NYHRKLIRQTFERXXRRYLXSDLQKLSRFI 226
N H + +RQ FE+ + + +L+K S FI
Sbjct: 469 NEHLEHLRQVFEKLKQARMTINLEK-SNFI 497
>EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive
peptide receptor 1 protein.
Length = 374
Score = 20.2 bits (40), Expect = 6.2
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = +1
Query: 241 LLQIAGQVPAT 273
LLQ+ GQ+P T
Sbjct: 272 LLQVFGQIPGT 282
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,464
Number of Sequences: 336
Number of extensions: 948
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used: 6770240
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)
- SilkBase 1999-2023 -