BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1283 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 28 0.30 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 23 8.5 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 8.5 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 8.5 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 8.5 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 27.9 bits (59), Expect = 0.30 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 492 PTMLAMTRPNQTRTSPGRRWD*C 560 P + A TR QTRTSPG+ ++ C Sbjct: 485 PAITAPTRVPQTRTSPGKVFERC 507 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 186 VPRFLPLPRRYIPSHQARG 130 +PRFLP P + +H+ G Sbjct: 33 LPRFLPRPHHTVSNHRIVG 51 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 125 LMRGLHSVRIVGWGEDAEDKYWIVANSWG 39 LM+ +H V+ WG+D E +A S G Sbjct: 66 LMKNIHKVQRDKWGKDIEFLLSCIALSVG 94 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 125 LMRGLHSVRIVGWGEDAEDKYWIVANSWG 39 LM+ +H V+ WG+D E +A S G Sbjct: 66 LMKNIHKVQRDKWGKDIEFLLSCIALSVG 94 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 19 PFSPHDVPQLLATIQYLSSASSPQPTILTLW 111 P S + Q + TI+Y+ S S + L LW Sbjct: 683 PMSEIFIHQAIHTIEYILSTISHTASYLRLW 713 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,668 Number of Sequences: 2352 Number of extensions: 16203 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -