BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1281 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.51 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.6 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 3.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.8 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.3 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.3 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 22 6.3 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 22 6.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.4 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.4 bits (53), Expect = 0.51 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -3 Query: 200 LVSNCLRRSEAAVMAAPRLLWTSKSWVQRCSCWSAVAARLAKPSQAMFQVSASS 39 ++ N + R EA+ PR S S ++C+ + + AR + SQ + Q + S+ Sbjct: 726 IIHNYIMRGEAS----PRSPNASPSPAEQCASTTTITARSPQGSQGLLQCATSN 775 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = +3 Query: 432 IEDIVSEFDRVSERIDELRQQI 497 + ++ + FD++SER ++LR +I Sbjct: 298 LNELFARFDQLSERFEQLRIKI 319 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 84 TCRHCRPTATTLDPT 128 TCR C + T LDP+ Sbjct: 374 TCRKCFKSRTNLDPS 388 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 574 RSLRASGAYQNLHGREQKTLRGIRSGRRCPR 666 R + Y LH E+K LR S RR R Sbjct: 259 REYKKDRRYDQLHNVEEKHLRERTSRRRYSR 289 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.8 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +3 Query: 321 LLRGHSKEAADDTEKNVKDLVEAYERLRQTLAARLADIE---DIVSEFDRVSERIDELRQ 491 LLRG + + NV L +LRQ L +L + I++E + ID L Sbjct: 46 LLRGQCISSRRNGRHNVHSLAFGAIQLRQLLKRQLCEKRKEVSIITEDSSRKQTIDPLSS 105 Query: 492 QIEVS 506 +++ Sbjct: 106 NTQIT 110 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 208 TRRRALDTRHALQELQAMSQVW 273 TRRR ++ HAL + ++W Sbjct: 34 TRRRRIEIAHALCLTERQIKIW 55 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 208 TRRRALDTRHALQELQAMSQVW 273 TRRR ++ HAL + ++W Sbjct: 34 TRRRRIEIAHALCLTERQIKIW 55 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 208 TRRRALDTRHALQELQAMSQVW 273 TRRR ++ HAL + ++W Sbjct: 34 TRRRRIEIAHALCLTERQIKIW 55 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 Query: 189 IGY*PEHQKACIGHQTCTPG 248 +GY +K C+ C PG Sbjct: 75 LGYLRNKKKVCVPRSKCLPG 94 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 208 TRRRALDTRHALQELQAMSQVW 273 TRRR ++ HAL + ++W Sbjct: 296 TRRRRIEIAHALCLTERQIKIW 317 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 19 YDQLHNVEEKHLRERTSRRRYSR 41 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 598 YQNLHGREQKTLRGIRSGRRCPR 666 Y LH E+K LR S RR R Sbjct: 268 YDQLHNVEEKHLRERTSRRRYSR 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,354 Number of Sequences: 438 Number of extensions: 4052 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -