BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1280 (517 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0726 + 10722759-10722857,10722969-10723058,10723141-107232... 29 2.2 02_05_0367 - 28331479-28332358,28332432-28332988,28333454-283336... 28 5.1 >03_02_0726 + 10722759-10722857,10722969-10723058,10723141-10723245, 10723597-10723698,10724721-10724805,10725281-10725365, 10725473-10725517,10725685-10728672,10728839-10729055, 10729193-10729765 Length = 1462 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 162 GSGCTRLIICGYVLDSNLNVVSASVSGR 245 GSGCT +I+CG V D V+A G+ Sbjct: 50 GSGCTHVIVCGLVYDDPA-CVAARAEGK 76 >02_05_0367 - 28331479-28332358,28332432-28332988,28333454-28333671, 28333748-28333831,28334199-28334373,28334572-28334574 Length = 638 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 440 RMGGCTYPRGPKRRCTNSNIICLSSTYKLTNYVSETIIHRAVST 309 ++G CT PR P + CT + + + S +L TI++ V T Sbjct: 359 KLGTCTQPRDPWKLCTVTQVEEVKSILRLLPIWLCTILYSVVFT 402 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,207,556 Number of Sequences: 37544 Number of extensions: 295591 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -