Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1280
         (517 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC035747-1|AAH35747.1|  242|Homo sapiens solute carrier family 3...    30   5.5  

>BC035747-1|AAH35747.1|  242|Homo sapiens solute carrier family 35
           (UDP-galactose transporter), member A2 protein.
          Length = 242

 Score = 29.9 bits (64), Expect = 5.5
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%)
 Frame = +2

Query: 50  AKLYTIIETKSLKFPS---TIPSSGQYAEACNLQTRSFPFRKWLHSSHYLWLCFRFQSKR 220
           A L   ++T  L  PS   T+ ++ QY    NL   +F        SH L LC R ++ R
Sbjct: 104 AVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALR 163

Query: 221 S 223
           S
Sbjct: 164 S 164


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,473,841
Number of Sequences: 237096
Number of extensions: 1699839
Number of successful extensions: 6896
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6818
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6896
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4876707572
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)