BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1280 (517 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035747-1|AAH35747.1| 242|Homo sapiens solute carrier family 3... 30 5.5 >BC035747-1|AAH35747.1| 242|Homo sapiens solute carrier family 35 (UDP-galactose transporter), member A2 protein. Length = 242 Score = 29.9 bits (64), Expect = 5.5 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +2 Query: 50 AKLYTIIETKSLKFPS---TIPSSGQYAEACNLQTRSFPFRKWLHSSHYLWLCFRFQSKR 220 A L ++T L PS T+ ++ QY NL +F SH L LC R ++ R Sbjct: 104 AVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALR 163 Query: 221 S 223 S Sbjct: 164 S 164 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,473,841 Number of Sequences: 237096 Number of extensions: 1699839 Number of successful extensions: 6896 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6896 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -