BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1280 (517 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S48157-1|AAB24152.1| 1490|Drosophila melanogaster DNA polymerase... 29 2.8 AY070529-1|AAL48000.1| 746|Drosophila melanogaster GM13460p pro... 29 2.8 AE014297-3026|AAF55908.2| 1488|Drosophila melanogaster CG6349-PA... 29 2.8 D90310-1|BAA14340.1| 1505|Drosophila melanogaster DNA polymerase... 29 4.9 AB011813-1|BAA32745.1| 1415|Drosophila melanogaster DNA polymera... 29 4.9 >S48157-1|AAB24152.1| 1490|Drosophila melanogaster DNA polymerase-primase 180 kdasubunit protein. Length = 1490 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 488 RLPQPFEPKCITCFTARMGGCTYPRGPKRRCTNSNIICLSSTYK 357 RL +PF +C+TC T ++ Y GP +NS+I L K Sbjct: 1289 RLCEPFRFQCVTCKTEQLMASAYRPGP----SNSHIAVLQQCAK 1328 >AY070529-1|AAL48000.1| 746|Drosophila melanogaster GM13460p protein. Length = 746 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 488 RLPQPFEPKCITCFTARMGGCTYPRGPKRRCTNSNIICLSSTYK 357 RL +PF +C+TC T ++ Y GP +NS+I L K Sbjct: 545 RLCEPFRFQCVTCKTEQLMASAYRPGP----SNSHIAVLQQCAK 584 >AE014297-3026|AAF55908.2| 1488|Drosophila melanogaster CG6349-PA protein. Length = 1488 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 488 RLPQPFEPKCITCFTARMGGCTYPRGPKRRCTNSNIICLSSTYK 357 RL +PF +C+TC T ++ Y GP +NS+I L K Sbjct: 1287 RLCEPFRFQCVTCKTEQLMASAYRPGP----SNSHIAVLQQCAK 1326 >D90310-1|BAA14340.1| 1505|Drosophila melanogaster DNA polymerase alpha protein. Length = 1505 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 488 RLPQPFEPKCITCFTARMGGCTYPRGPKRRCTNSNIICL 372 RL +PF +C+TC T ++ Y GP +NS+I L Sbjct: 1286 RLCEPFRFQCVTCKTEQLMASAYRPGP----SNSHIAVL 1320 >AB011813-1|BAA32745.1| 1415|Drosophila melanogaster DNA polymerase alpha 180K subunit protein. Length = 1415 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 488 RLPQPFEPKCITCFTARMGGCTYPRGPKRRCTNSNIICL 372 RL +PF +C+TC T ++ Y GP +NS+I L Sbjct: 1286 RLCEPFRFQCVTCKTEQLMASAYRPGP----SNSHIAVL 1320 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,971,719 Number of Sequences: 53049 Number of extensions: 517583 Number of successful extensions: 1091 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -