BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1280 (517 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 1.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 5.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.7 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 21 10.0 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 21 10.0 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 10.0 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 10.0 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 451 ASRHEWVVVPTRAGPKDAV 395 A+RH + VP AGP+ V Sbjct: 471 ANRHYYAFVPFSAGPRSCV 489 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 392 WYSVFWARAGRYN 430 W SVFW A ++N Sbjct: 164 WLSVFWGSAWQWN 176 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 5.7 Identities = 4/8 (50%), Positives = 6/8 (75%) Frame = +2 Query: 386 CCWYSVFW 409 CCW+ + W Sbjct: 488 CCWWKICW 495 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 5.7 Identities = 4/8 (50%), Positives = 6/8 (75%) Frame = +2 Query: 386 CCWYSVFW 409 CCW+ + W Sbjct: 541 CCWWKICW 548 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +2 Query: 146 RSFPFRKWLHSSHYLWLCFRFQSKRSLCL 232 ++ K H +HYL R + +LCL Sbjct: 19 QTLELEKEFHYNHYLTRRRRIEIAHALCL 47 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 253 SWNRPDTEAETT 218 SW+RP A+TT Sbjct: 46 SWSRPRESAQTT 57 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 20.6 bits (41), Expect = 10.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 359 KLTNYVSETIIHRAVSTII 303 KL YVSET + +V TI+ Sbjct: 108 KLRAYVSETSSYVSVLTIV 126 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = -2 Query: 120 YCPELGIVEGNFNDFVSIMVYSFAVKSEFSLQIFHI 13 +C G+V G F ++V F + +E +++ I Sbjct: 246 FCITFGLVAGQFGAQGKLIVDFFMILNEIIMKLVGI 281 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,483 Number of Sequences: 438 Number of extensions: 3657 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -