BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1279 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-57... 29 2.5 03_02_0102 + 5637469-5639064 28 5.7 04_04_0822 + 28352941-28353825,28353863-28354016,28354714-283547... 28 7.5 01_06_0680 + 31132683-31133499,31133597-31134717,31134811-31135713 28 7.5 10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836,811... 27 9.9 01_03_0066 - 12181117-12181281,12181677-12181750,12181832-12181883 27 9.9 >02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-579174, 579266-579370,579975-580028,580244-580344,580454-581423, 582030-582203,582341-582643,582719-582856,582993-583247, 584230-584370,585008-585289,585395-585540,585627-585690, 585723-585799,586285-586301,587728-587867,587972-588029, 588121-588218,588727-588776,589260-589743 Length = 2630 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 81 KYYKNLGCLIKNAKRKKHLVEHEQE-EKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEI 251 K+ N+ + KRK+ LVE+ QE EK D+ + ED F + + T+++++ Sbjct: 2330 KHTSNVLSKVHEQKRKQLLVEYNQEMEKLKQKYDSLLQKEDSFYAQKEAELDTIYRKV 2387 >03_02_0102 + 5637469-5639064 Length = 531 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 554 PPPFLARLILYSLFMPRRMAPQF*LLRGARSLLP 453 P PF LY L RR A + LLR +R L+P Sbjct: 108 PSPFALDTALYVLGRARRFAHMWDLLRSSRRLVP 141 >04_04_0822 + 28352941-28353825,28353863-28354016,28354714-28354754, 28355060-28355310,28355411-28355591,28356138-28356323, 28356396-28356569,28356992-28357150,28357424-28357501, 28357612-28357748,28357980-28358044,28358115-28358148, 28358216-28358372,28359135-28359196,28360041-28360118, 28360940-28361042 Length = 914 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 560 GQPPPFLARLILYSLFMPRRMAPQ 489 G PPPF L+ YSLF RR A Q Sbjct: 425 GYPPPFNVLLVCYSLF-ERRSAQQ 447 >01_06_0680 + 31132683-31133499,31133597-31134717,31134811-31135713 Length = 946 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 375 TCTSSPTSNPHAPTGATSS--XLNTLLGGKKTTCPTK*SELWSHPTWHE 515 TC+S+PT P P AT S + +LGG C L P ++E Sbjct: 537 TCSSNPTPPPSPPFIATPSPELIQNVLGGFSERCAKDGHWLMGLPNFNE 585 >10_01_0007 - 79867-79950,80258-80303,80409-80641,80765-80836, 81135-81230,81506-81607,81684-82349 Length = 432 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 403 GFEVGDEVHVHHLLVVYN 350 GF GD + VHH+LV N Sbjct: 159 GFRTGDTIAVHHILVFLN 176 >01_03_0066 - 12181117-12181281,12181677-12181750,12181832-12181883 Length = 96 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 649 RWVCKKFSPYDAVHKRTRTSWCTRCGC 569 R+V K YD R + W TR GC Sbjct: 25 RYVPKDVRSYDVERVRNKEQWSTRVGC 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,412,285 Number of Sequences: 37544 Number of extensions: 411858 Number of successful extensions: 965 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -