BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1279 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 33 0.15 SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6) 29 2.5 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 29 2.5 SB_42339| Best HMM Match : LIM (HMM E-Value=8.9) 28 7.7 SB_18769| Best HMM Match : LIM (HMM E-Value=8.9) 28 7.7 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +3 Query: 48 PTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAE 197 PT RT+ D+K ++ L+K K + + +E E K+W L NYM AE Sbjct: 87 PTFARTFAVDSKVTPSVIALLKQFKWEIVAIIYE-EWKKWVQLKNYMKAE 135 >SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6) Length = 416 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 219 CPVLKRDLRQPCSCLEDPIASPLVHVRLGASCAWRF**DSPSFCNIYC 76 CP + R + PC ++ P++ P +V S + + S C YC Sbjct: 71 CPYVNRTVSVPCPYVKRPVSVPCPYVNRAVSVPCPYVNRAVSVCQPYC 118 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 29.5 bits (63), Expect = 2.5 Identities = 24/90 (26%), Positives = 39/90 (43%) Frame = +2 Query: 140 RT*TRGEAMGSSRQLHGCRRSLFRTGQKPKTYPF*RNSRVKPDTMKLIVNWSGKEFLRET 319 R+ T G S+Q+ ++F+ G+K R +K + V W E RET Sbjct: 123 RSNTENRFDGISKQMELLGATIFKDGKKAT-----REKALKKGIHLVTVLWV--ESCRET 175 Query: 320 WTRFVEDSFPIVNDQ*VMDVYLVANLKPTR 409 R E+ FP++ + L+ LK T+ Sbjct: 176 GKRVAEELFPVIAQDELSTPLLMGKLKRTK 205 >SB_42339| Best HMM Match : LIM (HMM E-Value=8.9) Length = 279 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 75 DNKYYKNLGCLIKNAKRKKHL-VEHEQEEKQWDLLDNY 185 D N C+ K + +HL VE++Q +K W DN+ Sbjct: 168 DKTVDSNKCCICKEIQNLQHLFVEYKQVKKFWSAFDNW 205 >SB_18769| Best HMM Match : LIM (HMM E-Value=8.9) Length = 279 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 75 DNKYYKNLGCLIKNAKRKKHL-VEHEQEEKQWDLLDNY 185 D N C+ K + +HL VE++Q +K W DN+ Sbjct: 168 DKTVDSNKCCICKEIQNLQHLFVEYKQVKKFWSAFDNW 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,112,732 Number of Sequences: 59808 Number of extensions: 463139 Number of successful extensions: 1449 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1448 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -