BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1278 (372 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 104 3e-25 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 0.66 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 20 8.2 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 104 bits (250), Expect = 3e-25 Identities = 51/57 (89%), Positives = 52/57 (91%) Frame = +3 Query: 87 VLRDNIQGITKPAIRXLARXGGVKRISGLIYXETRGVLKVFLENVIRDAVTYTEHAR 257 VL DNIQGITKPAIR LAR GGVKRISGLIY ETRGVLKVFLENVIRDAVTYTEH + Sbjct: 22 VLGDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHTK 78 Score = 52.8 bits (121), Expect = 1e-09 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 254 QRKTVTAMDVVYALKRQGRTLYGFGG 331 +RKTVTAMDVVYALK QGRTLYGFGG Sbjct: 78 KRKTVTAMDVVYALKIQGRTLYGFGG 103 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 0.66 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 208 SSKT*SATLSHTPNTPEEDRHRYGCCVRSETPRSHP 315 SSK ++ P TPE + H YG S S P Sbjct: 69 SSKFEEDLMNKLPTTPEYNNHLYGSTPDSRDYFSRP 104 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.2 bits (40), Expect = 8.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 136 WLXXVE*NVSPVLYTKRPAAFSKCSSK 216 WL + V+PV+YT F K K Sbjct: 664 WLGYMNSFVNPVIYTVFNPEFRKAFHK 690 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,901 Number of Sequences: 438 Number of extensions: 1518 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -