BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1276 (525 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 24 0.83 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.4 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 24.2 bits (50), Expect = 0.83 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 277 VDLDSFKTNSGDIPLQYKEPPTRYSSESKTTTEEIPAAETSDEE 408 V+++S+ D+ + +KE P R E++ I ET+D + Sbjct: 177 VEIESYGYTVLDVVMYWKETPVRGVEEAELPQFTIIGYETNDRK 220 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 4.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -2 Query: 140 WLLFETYLPLCIL 102 + LF TY+P C++ Sbjct: 246 YYLFHTYIPTCLI 258 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 381 NFFSSRFALGGIPRRGLFVLKWDVTRVRFEAVE 283 N+ ++ A+ I L WD +R+ FEA + Sbjct: 717 NYDTAEEAIRDIKIGKLMAFIWDSSRLEFEAAQ 749 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,380 Number of Sequences: 438 Number of extensions: 2405 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -