BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1275 (470 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 26 0.76 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 1.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.1 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 23 7.1 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 23 7.1 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 7.1 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 22 9.4 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 25.8 bits (54), Expect = 0.76 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +2 Query: 116 YYIPSTVGTRSKAQ**IISEQ*CNEHDNLTCRPPCVISSSIN 241 + IP+ + ++S+ ISE+ CNE+ +LT + + ++N Sbjct: 74 FSIPTPLNSQSRGGSERISEKKCNEYKDLTTESVAISALTLN 115 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 1.3 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 131 LRECNIGMYVMFVIYLIC-LFLLTNMF 54 +RE NI MY+ FV ++I F N+F Sbjct: 1533 IRETNIYMYLYFVFFIIFGSFFTLNLF 1559 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.6 bits (46), Expect = 7.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 119 NIGMYVMFVIYLICLFLLTNMF 54 NI Y++C FL+ N+F Sbjct: 1399 NIAFPYFISFYVLCSFLIINLF 1420 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 22.6 bits (46), Expect = 7.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 317 SSRSDQSEREPTLV*FVVSIRKKKIKMHTQ 406 SS SD++E E + V VV R+KK + Q Sbjct: 20 SSESDEAEEESSSV-VVVQDRRKKANPNVQ 48 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 22.6 bits (46), Expect = 7.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 317 SSRSDQSEREPTLV*FVVSIRKKKIKMHTQ 406 SS SD++E E + V VV R+KK + Q Sbjct: 20 SSESDEAEEESSSV-VVVQDRRKKANPNVQ 48 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 22.6 bits (46), Expect = 7.1 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +1 Query: 49 LVNMLVNRNRQMR*ITNITYIPILHSLNC 135 ++ + R R+ I N Y P++ + NC Sbjct: 515 VLESFLQRGREYADIANAYYGPVIENFNC 543 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 22.2 bits (45), Expect = 9.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 101 MFVIYLICLFLLTNMFTRTEYSA 33 M V Y +C + TN+ R+ Y + Sbjct: 207 MDVYYFVCNYSFTNIMDRSVYQS 229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,224 Number of Sequences: 2352 Number of extensions: 8615 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -