BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1275 (470 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132952-5|CAB61137.1| 498|Caenorhabditis elegans Hypothetical ... 29 1.7 AF068718-5|AAC17768.1| 320|Caenorhabditis elegans Hypothetical ... 29 2.2 U51997-1|AAG24067.1| 572|Caenorhabditis elegans Activated in bl... 28 3.9 Z79604-3|CAD36502.1| 817|Caenorhabditis elegans Hypothetical pr... 27 6.8 Z79604-2|CAB01900.1| 780|Caenorhabditis elegans Hypothetical pr... 27 6.8 AL132902-13|CAL64008.1| 913|Caenorhabditis elegans Hypothetical... 27 6.8 AF332205-1|AAK17976.1| 817|Caenorhabditis elegans nuclear recep... 27 6.8 AF332204-1|AAK17975.1| 519|Caenorhabditis elegans nuclear recep... 27 6.8 X78553-1|CAA55296.1| 543|Caenorhabditis elegans cytoplasmic int... 27 9.0 AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical ... 27 9.0 >AL132952-5|CAB61137.1| 498|Caenorhabditis elegans Hypothetical protein Y51H4A.5 protein. Length = 498 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 134 QLRECNIGMYVMFVIYLICLFLLTNMFTRTEYSASH 27 +L C + + +F +Y+ C + T+ R EY+ SH Sbjct: 3 RLNMCQLYLLHLFFLYVCCWIVGTSALGRAEYTCSH 38 >AF068718-5|AAC17768.1| 320|Caenorhabditis elegans Hypothetical protein R01B10.4 protein. Length = 320 Score = 28.7 bits (61), Expect = 2.2 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = -1 Query: 218 MAVYTLSYHVRCTIVLR*FIIELYFEYLQLRECNIGMYVMFVIYLICLFLLTNMFTRTE 42 M + Y++ C IV LY +L R+ N+G I LI L + N+ T E Sbjct: 211 MQNFDYGYNMTCCIVFSLITTCLYVHHLYYRKRNLGSLQESDIVLIRLIIWANLSTALE 269 >U51997-1|AAG24067.1| 572|Caenorhabditis elegans Activated in blocked unfolded proteinresponse protein 2 protein. Length = 572 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 170 SEQ*CNEHDNLTCRPPC 220 S Q CN+H NL C+P C Sbjct: 196 SVQQCNQHCNLECQPTC 212 >Z79604-3|CAD36502.1| 817|Caenorhabditis elegans Hypothetical protein ZK662.3b protein. Length = 817 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -1 Query: 362 IRREWALVLIGRNAMTSLLCECVCARY 282 + ++ + LI +N+ ++ C C+C RY Sbjct: 478 VPKDMLMKLIQKNSRSTCTCSCMCGRY 504 >Z79604-2|CAB01900.1| 780|Caenorhabditis elegans Hypothetical protein ZK662.3a protein. Length = 780 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -1 Query: 362 IRREWALVLIGRNAMTSLLCECVCARY 282 + ++ + LI +N+ ++ C C+C RY Sbjct: 441 VPKDMLMKLIQKNSRSTCTCSCMCGRY 467 >AL132902-13|CAL64008.1| 913|Caenorhabditis elegans Hypothetical protein Y71A12B.17 protein. Length = 913 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 354 RVGSRSDWSERDDVTVVRMC 295 +VG RSDW E + VV MC Sbjct: 651 KVGLRSDWFEHQAMPVVDMC 670 >AF332205-1|AAK17976.1| 817|Caenorhabditis elegans nuclear receptor NHR-48 protein. Length = 817 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -1 Query: 362 IRREWALVLIGRNAMTSLLCECVCARY 282 + ++ + LI +N+ ++ C C+C RY Sbjct: 478 VPKDMLMKLIQKNSRSTCTCSCMCGRY 504 >AF332204-1|AAK17975.1| 519|Caenorhabditis elegans nuclear receptor NHR-48 protein. Length = 519 Score = 27.1 bits (57), Expect = 6.8 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -1 Query: 362 IRREWALVLIGRNAMTSLLCECVCARY 282 + ++ + LI +N+ ++ C C+C RY Sbjct: 180 VPKDMLMKLIQKNSRSTCTCSCMCGRY 206 >X78553-1|CAA55296.1| 543|Caenorhabditis elegans cytoplasmic intermediate filamentprotein protein. Length = 543 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 266 YTQYGYIARTHIRTTVTSSR 325 Y +G R+HI+TTV SSR Sbjct: 524 YNSHGIEKRSHIQTTVASSR 543 >AF039043-1|AAB94194.1| 5105|Caenorhabditis elegans Hypothetical protein F39C12.1 protein. Length = 5105 Score = 26.6 bits (56), Expect = 9.0 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +3 Query: 336 QNESPLSSDSSCLFVKKKSKCIHNNNNKKMCYANRVRHC 452 + ++P S + C +KK ++ N+K M R+R C Sbjct: 1043 EGDTPFSQRAECPIEEKKQTAKYDENDKFMFPLGRLRFC 1081 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,682,092 Number of Sequences: 27780 Number of extensions: 186715 Number of successful extensions: 585 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 850313440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -