BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1275 (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36180.1 68417.m05148 leucine-rich repeat family protein cont... 27 4.8 At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, ... 27 8.5 At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.5 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 27 8.5 >At4g36180.1 68417.m05148 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1136 Score = 27.5 bits (58), Expect = 4.8 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +2 Query: 302 RTTVTSSRSDQSEREPTLV*FVVSIRKKKIKMHTQQQQQKNVLRKSRKTLL 454 R ++SRS EP LV F I + T+Q ++NVL ++R LL Sbjct: 805 RVRSSTSRSSTENGEPKLVMFNNKITLAETIEATRQFDEENVLSRTRYGLL 855 >At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit (Ath-A), Arabidopsis thaliana Length = 1069 Score = 26.6 bits (56), Expect = 8.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 188 RCTIVLR*FIIELYFEYLQLRECNIGMYVMFVIYLIC 78 R IVLR I+ L+F Y L N Y +++I +IC Sbjct: 264 RMLIVLRLVILGLFFHYRILHPVN-DAYALWLISVIC 299 >At3g50740.1 68416.m05552 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 487 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 251 D*TSNYTQYGYIARTHIRTTVTSSRSDQSE 340 D T +Y G+++RTH R + SS + Q+E Sbjct: 326 DGTPDYLPEGFVSRTHERGFMVSSWAPQAE 355 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 26.6 bits (56), Expect = 8.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 116 IGMYVMFVIYLICLF 72 +G YV F+ +L+CLF Sbjct: 4 LGFYVTFIFFLVCLF 18 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,784,167 Number of Sequences: 28952 Number of extensions: 160441 Number of successful extensions: 381 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -