BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1274 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_50883| Best HMM Match : MAM33 (HMM E-Value=1.7e-23) 28 6.3 SB_17889| Best HMM Match : Patched (HMM E-Value=0.14) 28 6.3 SB_55107| Best HMM Match : ABC_membrane (HMM E-Value=0.056) 28 8.3 SB_54864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/24 (41%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = -3 Query: 317 YQMNNW-TYHLHNLKLKTWRLSYL 249 Y+++ W T+ LH+L+L+ WR+ +L Sbjct: 260 YEVSGWSTFILHDLELRCWRMVHL 283 >SB_50883| Best HMM Match : MAM33 (HMM E-Value=1.7e-23) Length = 200 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 638 NVGRDVTYVDEKSSDQRRPVTNDT 567 NV D +YV + SD RP DT Sbjct: 65 NVNEDQSYVSDAESDNERPANEDT 88 >SB_17889| Best HMM Match : Patched (HMM E-Value=0.14) Length = 925 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 562 NNFIMTLKNVGSVCKIMCDHNANIFCIQK 476 NN ++TL G+ +I+ HN NIF + + Sbjct: 666 NNTVLTLPTNGAKAQILMRHNGNIFNVSQ 694 >SB_55107| Best HMM Match : ABC_membrane (HMM E-Value=0.056) Length = 219 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 516 ILHTLPTFLSVIIKLFISIIRHRSSLVTALLINVCYIPAHIS 641 I + P FLSVII L I + + S++T L + Y+ H+S Sbjct: 149 ITYATPLFLSVIIPLGIVYVLIQVSILTTPL-GIVYVLIHVS 189 >SB_54864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 528 VYVRLCVIIMLIFSVYKKVIRFKKKSNKYIINFRKHE 418 +YVR+ I +++ K +K NKY+ NF K E Sbjct: 371 IYVRMDFSISKVYTKLKSKPALAEKLNKYLNNFNKTE 407 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,347,896 Number of Sequences: 59808 Number of extensions: 330735 Number of successful extensions: 635 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -