BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1266 (677 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0274 + 16426892-16427101,16427193-16427572,16427655-164279... 28 6.0 08_01_0892 - 8778097-8778236,8778390-8778486,8778568-8778747,877... 28 6.0 >10_08_0274 + 16426892-16427101,16427193-16427572,16427655-16427927, 16428315-16428390,16428476-16428655 Length = 372 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 562 EATVQWLCFIFPHFCTFTDTKLLINPRYYTFKPE 663 +A +C +FP F + + +NPRY++ PE Sbjct: 319 DAIFDKICGMFPGFMSMAYSVQAVNPRYWSNNPE 352 >08_01_0892 - 8778097-8778236,8778390-8778486,8778568-8778747, 8779138-8779247,8781153-8781294,8782298-8782686, 8782752-8782834,8783524-8785244,8785894-8786040, 8786121-8786264,8786669-8786741,8787413-8787633 Length = 1148 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 294 IPLNSSIEVS*NGSFYWSIILSYVVSFNSIKFGIN 190 +P+N++ +S W +I + V F+S+KFGI+ Sbjct: 833 VPVNTTCSLSICREILWFLIGTREVPFSSVKFGIS 867 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,699,361 Number of Sequences: 37544 Number of extensions: 284871 Number of successful extensions: 438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -