BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1263 (561 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|... 26 3.3 SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antip... 25 5.8 SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizo... 25 5.8 >SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 26.2 bits (55), Expect = 3.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 209 VFSDTFKHARKLIKEHDYFCANLKCI*LK*LF 114 + SDT H KL++ H + NLK + + LF Sbjct: 782 LLSDTRSHLHKLVQHHYFASRNLKLLYVDLLF 813 >SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antiporter Sod22|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.4 bits (53), Expect = 5.8 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 522 GSVLAHSSLSPVSSPTHVRAKLX*PLKAISKGRKKKRILWPIYNTFAR 379 G++++H+S + P+ KA S GRK + L Y+TF R Sbjct: 574 GNIISHTSSRDANGPSIDEKLAQGDPKAKSFGRKFRSFLRRSYDTFQR 621 >SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 457 Score = 25.4 bits (53), Expect = 5.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 194 FKHARKLIKEHDYFCANLK 138 F HA KL K++ Y C N K Sbjct: 293 FVHAEKLTKQNKYRCENCK 311 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,712,856 Number of Sequences: 5004 Number of extensions: 27269 Number of successful extensions: 47 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -