BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1263 (561 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0161 - 1385408-1385566,1385815-1385943,1386164-1386322,138... 28 5.9 >01_01_0161 - 1385408-1385566,1385815-1385943,1386164-1386322, 1387228-1387571,1387641-1387905,1387998-1388075, 1388207-1388260,1389341-1389361,1389453-1389578, 1389696-1389863,1389923-1390313,1390629-1390710, 1391175-1391536,1391806-1392630,1392956-1393476 Length = 1227 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = -1 Query: 528 LLGSVLAHSSLSPVSSPTHVRAKLX*PLKAISKGRKKKRILWPIYNTFARRFSNVCFLLG 349 + SV+ +S P + +H+ K + R K+++L Y TF + N+ LL Sbjct: 202 MYSSVVGNSGFEPRAIISHIEDKFKYTITYAKAWRAKQKVLEMRYGTFEASYDNLQRLLA 261 Query: 348 L 346 + Sbjct: 262 I 262 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,600,312 Number of Sequences: 37544 Number of extensions: 137993 Number of successful extensions: 206 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 206 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -