BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1261 (737 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 27 0.21 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 27 0.21 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 4.5 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 622 ITVIYFYFKINRIILFAIDRRLKYMFLG 539 I+V FY + + L A+DRR K+M LG Sbjct: 147 ISVDRFYAVLKPLYLRALDRRDKFMLLG 174 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 622 ITVIYFYFKINRIILFAIDRRLKYMFLG 539 I+V FY + + L A+DRR K+M LG Sbjct: 147 ISVDRFYAVLKPLYLRALDRRDKFMLLG 174 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -2 Query: 706 DIR*GFRKMDGVIMGSNVTGVQQ---PVPKDITVIYFY 602 D+ + K + + G V +Q P P DI YFY Sbjct: 8 DVGQSWLKSNSSLAGFEVNSSEQLTTPTPTDINSFYFY 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,304 Number of Sequences: 336 Number of extensions: 3955 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -