BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1261 (737 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0109 - 5368342-5369592 33 0.31 08_02_1172 + 24898290-24899141,24900864-24901328 29 5.1 07_03_0831 - 21810002-21810319,21810423-21810573,21810660-218108... 29 5.1 07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358 28 6.7 06_03_1112 - 27706813-27707175,27707225-27707299,27707515-277076... 28 6.7 01_01_0056 + 422141-422379,422524-422620,422697-422774,422871-42... 28 6.7 >10_02_0109 - 5368342-5369592 Length = 416 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -2 Query: 547 FLGTAMYTEDSSGSEVPCP-KFELCVNTCWRVFE 449 +LG A+ T+DS G V C +FE+ + TC+ ++E Sbjct: 179 YLGAALRTDDSDGGGVVCSFEFEIILVTCYNMWE 212 >08_02_1172 + 24898290-24899141,24900864-24901328 Length = 438 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 3 HPQPPR--FHPSPVRGNHLAPFCPP 71 H PP FHP PV H AP PP Sbjct: 64 HQYPPAAFFHPPPVHQQHQAPPSPP 88 >07_03_0831 - 21810002-21810319,21810423-21810573,21810660-21810897, 21811011-21811221,21811336-21811559,21811696-21811806, 21813265-21813636,21813810-21814782 Length = 865 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -2 Query: 670 IMGSNVTGVQQPVPKDITVIY--FYFKINRIILFAIDRRLKYMFLGTAMYTEDSSGSEVP 497 + G + G P+ D+++ + F + R +L YM LG+ + S +P Sbjct: 239 VYGFKLNGDPPPIAGDMSIAFTPFNSSLYRFVLRPNGVETCYMLLGSGDWELVWSQPTIP 298 Query: 496 CPKFELC 476 C ++ LC Sbjct: 299 CHRYNLC 305 >07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358 Length = 717 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -2 Query: 496 CPKFELCVNTCWRVFEQNHRSTSLDISAITKLDYVDS 386 C K + CW+V ++ R + S +T +Y DS Sbjct: 165 CKKKNHFIEECWKVQDKEKRKSDGKASVVTSAEYSDS 201 >06_03_1112 - 27706813-27707175,27707225-27707299,27707515-27707665, 27707953-27708190,27708280-27708490,27708565-27708680, 27708805-27708847,27709817-27709859,27709941-27710056 Length = 451 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 496 CPKFELCVNTCWRVFEQNHRSTSLDISAITKLDYVDSC 383 C F C T W+ ++Q ++D S + +D ++C Sbjct: 322 CYNFGFCHPTTWKCYDQGCLEKAIDSSMVDDVDVDEAC 359 >01_01_0056 + 422141-422379,422524-422620,422697-422774,422871-422930, 423019-423123,423743-423856,424145-424186,424380-424496, 424568-424755,425502-425785,425869-425990,426118-426160, 426265-426356,427331-427379,427623-427693,427793-427912, 428586-428674,429266-429311,429926-429973 Length = 667 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 462 QHVFTHNSNFGHGTSLPLLSSVYIAVPRNMYL 557 QH H++++GHG S+ L+S + P YL Sbjct: 397 QHAREHSAHWGHGDSVNLVSGIEDTNPSYPYL 428 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,958,168 Number of Sequences: 37544 Number of extensions: 414145 Number of successful extensions: 1045 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1045 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -