BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1258 (640 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O66504 Cluster: Uncharacterized protein aq_097; n=1; Aq... 33 4.4 UniRef50_Q23WT2 Cluster: Putative uncharacterized protein; n=1; ... 33 5.8 UniRef50_UPI0000E483D3 Cluster: PREDICTED: similar to UDP-Glucur... 33 7.7 >UniRef50_O66504 Cluster: Uncharacterized protein aq_097; n=1; Aquifex aeolicus|Rep: Uncharacterized protein aq_097 - Aquifex aeolicus Length = 407 Score = 33.5 bits (73), Expect = 4.4 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 232 HTPPKRLDDFDEIFCAYPVSMRIGQHLFFIPL 327 H PPK+LD+ + IF A VS+ +G L F PL Sbjct: 272 HNPPKKLDETEIIFLASAVSLVLGYLLRFGPL 303 >UniRef50_Q23WT2 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1261 Score = 33.1 bits (72), Expect = 5.8 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = +3 Query: 399 YDTTYKNTYNPQFSPFYDQPLFFNSHFSNLIIFPLRSKLINRHLISYPRQMSTGVTSDPV 578 Y T NT N F+P+ + FN +S +I+ L SK + +P S V D V Sbjct: 809 YSTDKCNTQNTIFNPYLKKAYLFN--YSKVIVVDLYSKTDTQLAYGHPTTNSVTVIQDSV 866 Query: 579 N 581 N Sbjct: 867 N 867 >UniRef50_UPI0000E483D3 Cluster: PREDICTED: similar to UDP-Glucuronosyltransferase UGT2B33, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to UDP-Glucuronosyltransferase UGT2B33, partial - Strongylocentrotus purpuratus Length = 420 Score = 32.7 bits (71), Expect = 7.7 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = +1 Query: 208 FSCHSFRCHTPPKRLDDFDEIFCAYPVSMRI----GQHLFFIPLNVRGSPTL 351 F+ S+ H P+ L+ F E+F YP + G+H F +P NV+ P L Sbjct: 209 FTLGSYVTHIKPEFLEPFAEVFQRYPQQKILWQLAGEHKFKLPPNVKTMPWL 260 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,222,273 Number of Sequences: 1657284 Number of extensions: 10455992 Number of successful extensions: 22298 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22268 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47711253245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -