BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1258 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0636 + 19567654-19568859 29 3.1 02_01_0333 + 2370032-2371075 28 7.2 >08_02_0636 + 19567654-19568859 Length = 401 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 138 NKENITHTTMYLTHTHILYLIYKILVSQFSLPYSSE 245 NKE T + +++T +H+LY + ++ Q PY +E Sbjct: 76 NKEPTTASVLHVTMSHVLYPVTAEVLLQVFSPYGAE 111 >02_01_0333 + 2370032-2371075 Length = 347 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 1 AKTVYPFLRKLRGRRSMKFLTLIGN 75 A T YP KL G++ M+FL L GN Sbjct: 58 AMTFYPPFSKLPGKQQMEFLLLGGN 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,000,469 Number of Sequences: 37544 Number of extensions: 261182 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -