BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1257 (616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase P... 26 5.0 SPAC607.08c |||DUF726 family protein|Schizosaccharomyces pombe|c... 25 6.6 >SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase Ppk21|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 168 AINEGHARAAEAVVQHNTEAVRQAAEASRRFTKP 269 A N A A+ ++V+H A RQ RFT P Sbjct: 357 AANAAAAFASASIVKHQETARRQELPTVNRFTAP 390 >SPAC607.08c |||DUF726 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 579 Score = 25.4 bits (53), Expect = 6.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 401 GIAAPYGIAAPYTAYGAYGVXPTASAFTLGKPITTAAVI 517 G+AAP+ A T + G+ A LG IT+A +I Sbjct: 191 GLAAPFVAAGLGTLFAGLGLGTMIGATYLGTLITSAPMI 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,409,730 Number of Sequences: 5004 Number of extensions: 15829 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -