BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1257 (616 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 28 4.3 At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden... 27 9.9 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 395 PYGIAAPYGIAAPYTAYGAYGVXPTASAFTLGKPITTA 508 P+ A P+G +AP+ A + + S G P T++ Sbjct: 34 PFAPATPFGTSAPFAAQSGSSIFGSTSTGVFGAPQTSS 71 >At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly identical to RNA helicase [Arabidopsis thaliana] GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00098: Zinc knuckle Length = 747 Score = 27.1 bits (57), Expect = 9.9 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = -1 Query: 523 LENNGRGRD---RFTKRERRGCRGDXVSAVSGVGRGDSVRCGDAIGGSD 386 L+++G D RF+ R+R RG S S GRG S R D+ GG D Sbjct: 631 LQDDGPSSDNYGRFSSRDRMP-RGGGGSRGSRGGRGGSSRGRDSWGGDD 678 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,545,267 Number of Sequences: 28952 Number of extensions: 88875 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -