BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1256 (646 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 147 8e-36 SB_56| Best HMM Match : Actin (HMM E-Value=0) 147 8e-36 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 146 1e-35 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 146 1e-35 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 145 2e-35 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 145 3e-35 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 130 7e-31 SB_54| Best HMM Match : Actin (HMM E-Value=0) 47 2e-05 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 46 2e-05 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 42 3e-04 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 31 0.80 SB_35821| Best HMM Match : TUDOR (HMM E-Value=0) 30 1.9 SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) 29 3.2 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_41148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) 28 5.7 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 28 7.5 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1465| Best HMM Match : PAN (HMM E-Value=0.012) 27 9.9 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 147 bits (356), Expect = 8e-36 Identities = 68/71 (95%), Positives = 69/71 (97%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 MYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 306 MYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 365 Query: 326 SGPSIVHRKCF 294 SGPSIVHRKCF Sbjct: 366 SGPSIVHRKCF 376 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM++ GIHETTYNSI+KCDVDIRKDLYANTVLSGG+ Sbjct: 261 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGS 304 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 147 bits (356), Expect = 8e-36 Identities = 68/71 (95%), Positives = 69/71 (97%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 MYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 305 MYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 364 Query: 326 SGPSIVHRKCF 294 SGPSIVHRKCF Sbjct: 365 SGPSIVHRKCF 375 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM++ GIHETTYNSI+KCDVDIRKDLYANTVLSGG+ Sbjct: 260 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGS 303 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 146 bits (355), Expect = 1e-35 Identities = 68/71 (95%), Positives = 69/71 (97%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 MYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 306 MYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 365 Query: 326 SGPSIVHRKCF 294 SGPSIVHRKCF Sbjct: 366 SGPSIVHRKCF 376 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM++ GIHETTYNSI+KCDVDIRKDLYANTVLSGG+ Sbjct: 261 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGS 304 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 146 bits (355), Expect = 1e-35 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 MYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 279 MYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 338 Query: 326 SGPSIVHRKCF 294 SGP+IVHRKCF Sbjct: 339 SGPAIVHRKCF 349 Score = 77.0 bits (181), Expect = 1e-14 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 +L P LGM++ GIHETTYNSI+KCDVDIRKDLYANTV+SGGT Sbjct: 234 ALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGT 277 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 145 bits (352), Expect = 2e-35 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 MYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 268 MYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 327 Query: 326 SGPSIVHRKCF 294 SGP+IVHRKCF Sbjct: 328 SGPAIVHRKCF 338 Score = 77.4 bits (182), Expect = 9e-15 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM++ GIHETTYNSI+KCDVDIRKDLYANTVLSGGT Sbjct: 223 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGT 266 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 145 bits (351), Expect = 3e-35 Identities = 67/71 (94%), Positives = 69/71 (97%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 M+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEY E Sbjct: 305 MFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 364 Query: 326 SGPSIVHRKCF 294 SGPSIVHRKCF Sbjct: 365 SGPSIVHRKCF 375 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM++ GIHETTYNSI+KCDVDIRKDLYANTVLSGG+ Sbjct: 260 AMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGS 303 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 130 bits (315), Expect = 7e-31 Identities = 58/71 (81%), Positives = 65/71 (91%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXE 327 M+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQQMWI+K+EY E Sbjct: 79 MFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEEYHE 138 Query: 326 SGPSIVHRKCF 294 GP IVHRKCF Sbjct: 139 YGPPIVHRKCF 149 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 ++ P LGM+A GIHE YN I+KCDVDIRKDLY+N VLSGG+ Sbjct: 34 AMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGS 77 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -1 Query: 637 LSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSG 515 L P LG GIHE+ + SI KCD+D+R +L+ N VLSG Sbjct: 2306 LFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/60 (36%), Positives = 35/60 (58%) Frame = -3 Query: 461 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYXESGPSIVHRKCF*THR 282 + P ++ ++I+ ++Y+VW GGS+LAS F + +K +Y E GPSI F HR Sbjct: 285 IKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPF-LHR 343 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 598 IHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 + E N I C +D+R+ LY N VLSGG+ Sbjct: 223 LSEVVDNVIQNCPIDVRRPLYKNIVLSGGS 252 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/45 (40%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -3 Query: 497 GIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASL 372 G +R+ +E+ + P +M++K+I+ E++++ WIGGSILASL Sbjct: 186 GFVERLNRELVSKTPPSMRLKLISNNSSVEKRFNPWIGGSILASL 230 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 616 GMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGG 512 G A G+ + S+ D+DIR L+ + +++GG Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGG 180 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/42 (40%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 443 KIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYXESG 321 KI+I PP RK+ V++GG++LA + W++++EY E G Sbjct: 358 KIRIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -1 Query: 640 SLSNPRSLGMKACGIHETTYNSIIKCDVDIRKDLYANTVLSGGT 509 +L P + ++ G+ E +N+I D+D R + Y + VLSGG+ Sbjct: 264 ALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGS 307 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -1 Query: 577 SIIKCDVDIRKDLYANTVLSGGT 509 +I K D+D+R+ LY+N VLSGG+ Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGS 286 >SB_35821| Best HMM Match : TUDOR (HMM E-Value=0) Length = 754 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 6/68 (8%) Frame = -1 Query: 412 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTG------SASKRTARRCLQQPAAA 251 S YG +S+P S+ +NK R + PPL +G ++ K A PA Sbjct: 571 SAGYGKEAKSAPVSIAANKPFIRPSQDQQVMPPLISGIQAMCETSPKEQAIASANLPAVG 630 Query: 250 AQFRLVIS 227 F+L+++ Sbjct: 631 ETFQLIVT 638 >SB_39041| Best HMM Match : rve (HMM E-Value=2.3e-10) Length = 1164 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -2 Query: 420 REEVLRMDRWIDPRLPLYLPTN---VDLETRVXRVWPLHCTQEVLLNAPRV 277 ++ L +DRW R+P+ N D+E R WP+H + L P V Sbjct: 366 KKVTLAVDRWNQARMPITNKHNQPYFDVEVRRDAWWPVHPEKGKALQTPPV 416 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 412 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 293 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -1 Query: 370 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 260 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 8/72 (11%) Frame = -3 Query: 596 PRDHI*LHHKVRRGHP*GLVRQHRIVRWYPMYPGIADRMQKEI--------TALAPSTMK 441 P+ + L ++ GHP G+VR + R Y +PG+ +++++ A APST Sbjct: 954 PQGRVKLLQELHDGHP-GMVRMKMLARSYFWWPGLDANIEQKVKDCTSCQSNAKAPSTAP 1012 Query: 440 IKIIAPPERKYS 405 + P R +S Sbjct: 1013 LHPWEWPSRPWS 1024 >SB_41148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 340 KSTTSLAPPLYTGSASKRTARRCLQQPAAAAQFRL 236 K+T P++T S K+T R C++ P + R+ Sbjct: 18 KNTLRFIMPVFTRSGRKKTNRTCIEDPTPQTERRV 52 >SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) Length = 1217 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 477 LHTVGDSRVHGVPPDNTVLAYKSLRMSTS 563 L T GD +H +PP +T L+ +SL S S Sbjct: 949 LFTTGDDFLHNIPPISTSLSNQSLNNSFS 977 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 394 VDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSA-SKRTA 281 VD+S P SLP+ K G + S P GS+ SK TA Sbjct: 1939 VDKSEPGSLPTVKFGVTTTADASSMPKFQFGSSGSKDTA 1977 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 334 TTSLAPPLYTGSASKRTARRCLQQPAAAA 248 T+S+AP +TG+++ A +Q PAAAA Sbjct: 2185 TSSVAPFSFTGTSTTTAAATGIQAPAAAA 2213 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 9/69 (13%) Frame = -3 Query: 506 MYPGIADRMQKEITALAPSTM--------KIKIIAPP-ERKYSVWIGGSILASLSTFQQM 354 M PG R+ +EI L S +K+ PP + W+GG+I SL Sbjct: 89 MTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADR 148 Query: 353 WISKQEYXE 327 +++ Y + Sbjct: 149 STTRERYQQ 157 >SB_1465| Best HMM Match : PAN (HMM E-Value=0.012) Length = 406 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 502 YMGYHRTIRCWRTSPYGCPRRTL*WSYMWSRGC 600 Y+G H + CW GCP + ++ SR C Sbjct: 49 YLGGHNSCDCWHPIIEGCPGASKIVNFAESRDC 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,384,254 Number of Sequences: 59808 Number of extensions: 404621 Number of successful extensions: 1130 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1124 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -