BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1255 (367 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0683 + 10363963-10364037,10364112-10364185,10364312-103644... 88 2e-18 05_03_0610 - 16167557-16167679,16168236-16168418,16169291-161694... 74 3e-14 02_02_0695 - 13024639-13024800,13025425-13025607,13025635-13025679 46 7e-06 04_01_0483 + 6343599-6343778,6343886-6344011,6344096-6344173,634... 29 1.5 04_01_0480 + 6279576-6279755,6279863-6279988,6280074-6280151,628... 29 1.5 03_02_0488 - 8824980-8825267,8825364-8827775 29 1.5 03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684,951... 28 2.0 04_01_0485 + 6389646-6389665,6390063-6390123,6390231-6390356,639... 28 2.6 01_01_0823 - 6407635-6407731,6407786-6407857,6409766-6409872 27 4.5 11_02_0078 - 8074247-8074837,8075815-8076341,8076453-8077022,807... 26 7.9 11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238,792... 26 7.9 10_08_0058 + 14521922-14522779 26 7.9 04_04_0378 - 24822436-24822521,24822623-24822738,24823010-248230... 26 7.9 >03_02_0683 + 10363963-10364037,10364112-10364185,10364312-10364435, 10365047-10365229,10365478-10365600 Length = 192 Score = 87.8 bits (208), Expect = 2e-18 Identities = 46/99 (46%), Positives = 67/99 (67%), Gaps = 2/99 (2%) Frame = +3 Query: 3 KIIKASGAEADSFETSISQALVELET-NSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 176 KI K G E FE S++QA +LE N +LK++L++LYI A ++++ N+K+++I+VP Sbjct: 7 KIQKEKGLEPSEFEDSVAQAFFDLENGNQELKSELKDLYINNAVQMDIAGNRKAVVIHVP 66 Query: 177 MPKLKAFQKIQIRLVRELEKKFSGKH*SLLETVRSCLSP 293 KAF+KI +RLVRELEKKFSGK ++ T R P Sbjct: 67 YRLRKAFKKIHVRLVRELEKKFSGKDVVIVATRRIVRPP 105 Score = 29.5 bits (63), Expect = 0.85 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 254 LVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAI 367 +V V R+I+ P + V +RPR+RTLT+V+D I Sbjct: 93 VVIVATRRIVRPPKKGSAV----QRPRTRTLTAVHDGI 126 >05_03_0610 - 16167557-16167679,16168236-16168418,16169291-16169414, 16169514-16169626,16169668-16169742 Length = 205 Score = 74.1 bits (174), Expect = 3e-14 Identities = 41/81 (50%), Positives = 56/81 (69%), Gaps = 2/81 (2%) Frame = +3 Query: 57 QALVELET-NSDLKAQLRELYITKAKEIELH-NKKSIIIYVPMPKLKAFQKIQIRLVREL 230 QA +LE N +LK+ L++LYI A +++L N+K++IIYVP KA++KI +RLVREL Sbjct: 38 QAFFDLENGNQELKSDLKDLYINGAVQMDLPGNRKAVIIYVPYRLRKAYKKIHVRLVREL 97 Query: 231 EKKFSGKH*SLLETVRSCLSP 293 EKKFSGK L+ T R P Sbjct: 98 EKKFSGKDVVLVATRRIVRPP 118 Score = 29.1 bits (62), Expect = 1.1 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +2 Query: 254 LVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAI 367 +V V R+I+ P + V RPR+RTLT+V+D I Sbjct: 106 VVLVATRRIVRPPKKGSAVV----RPRTRTLTAVHDGI 139 >02_02_0695 - 13024639-13024800,13025425-13025607,13025635-13025679 Length = 129 Score = 46.4 bits (105), Expect = 7e-06 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = +3 Query: 111 LYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKH*SLLETVRSCLS 290 +Y+ ++ N K ++I+V KAF+KI +RLV+ELEKKFSGK + + R + Sbjct: 31 MYVCSQMDVAA-NWKVVVIHVLYHLCKAFKKIHVRLVKELEKKFSGKD-VVFDATRRIVR 88 Query: 291 PATK 302 P K Sbjct: 89 PLNK 92 >04_01_0483 + 6343599-6343778,6343886-6344011,6344096-6344173, 6344859-6344984,6345253-6345354,6345425-6345571, 6345861-6345984,6346992-6347152 Length = 347 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +3 Query: 63 LVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAF 197 LVE+ D ++ + Y+ + L++K +++Y+ K+ F Sbjct: 113 LVEIRAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKISGF 157 >04_01_0480 + 6279576-6279755,6279863-6279988,6280074-6280151, 6280847-6280972,6281244-6281345,6281416-6281490, 6281852-6281975,6283005-6283107,6283546-6283617, 6283662-6283788,6284125-6284180,6284438-6284453 Length = 394 Score = 28.7 bits (61), Expect = 1.5 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 63 LVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAF 197 LVE+ D ++ + Y+ + L +K ++IY+ K+ F Sbjct: 113 LVEIRAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKISGF 157 >03_02_0488 - 8824980-8825267,8825364-8827775 Length = 899 Score = 28.7 bits (61), Expect = 1.5 Identities = 18/66 (27%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +3 Query: 12 KASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIY-VPMPKL 188 ++SG + FET +S A++E+E N+ L + +K+I H++ I Y P+P + Sbjct: 305 QSSGVTGEVFETLVSSAVMEMERNASLSP------VGFSKDIGQHHEFPRIPYSCPLPIM 358 Query: 189 KAFQKI 206 + +++ Sbjct: 359 DSSEEL 364 >03_02_0568 + 9514715-9514944,9515174-9515300,9515529-9515684, 9515765-9516102,9516191-9516329,9517083-9517152, 9517201-9517307,9517387-9517437,9517549-9517660, 9517783-9517869,9517958-9518133,9518479-9518586, 9518654-9518812,9518888-9518971,9519053-9519258, 9519565-9519666,9519768-9519877,9519963-9520114, 9520380-9520548,9520841-9520878,9521963-9522571, 9523314-9523784,9523786-9523871,9524396-9524906, 9525388-9525412,9526001-9526051,9526228-9526301, 9526412-9526534,9526667-9526738,9526924-9527020, 9527174-9527283 Length = 1649 Score = 28.3 bits (60), Expect = 2.0 Identities = 21/92 (22%), Positives = 44/92 (47%) Frame = +3 Query: 9 IKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKL 188 I SGA + + S L +L + Q ++YITK +++ +K+ IY+P + Sbjct: 323 IARSGAREANQKVCKSVILKDLYQEMERMKQGSQVYITKLSDVKAAREKN-GIYIPQERF 381 Query: 189 KAFQKIQIRLVRELEKKFSGKH*SLLETVRSC 284 A ++ + + +R+ + ++ L + SC Sbjct: 382 -ALEEAEKKTMRDKIEYLETQNKELKMNIESC 412 >04_01_0485 + 6389646-6389665,6390063-6390123,6390231-6390356, 6390441-6390518,6391304-6391429,6391630-6391731, 6391802-6391948,6392237-6392360,6393608-6393737, 6393908-6394130 Length = 378 Score = 27.9 bits (59), Expect = 2.6 Identities = 10/45 (22%), Positives = 22/45 (48%) Frame = +3 Query: 63 LVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAF 197 LVE+ D ++ + Y+ + L +K +++Y+ K+ F Sbjct: 80 LVEIRAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKISGF 124 >01_01_0823 - 6407635-6407731,6407786-6407857,6409766-6409872 Length = 91 Score = 27.1 bits (57), Expect = 4.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 60 ALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIY 170 A++E+E N DL + L T+ E H + S++IY Sbjct: 2 AILEIEDNDDLLSLPGSLANTRIGESPSHQRDSLLIY 38 >11_02_0078 - 8074247-8074837,8075815-8076341,8076453-8077022, 8077725-8077752 Length = 571 Score = 26.2 bits (55), Expect = 7.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 330 GLFCLLATRVLWLGLG 283 GL+ +LA R+LWL +G Sbjct: 517 GLYTVLAPRILWLAIG 532 >11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238, 7921808-7922407 Length = 1071 Score = 26.2 bits (55), Expect = 7.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 330 GLFCLLATRVLWLGLGRILRS 268 GL+ +LA R+LWL +G L S Sbjct: 1017 GLYTVLAPRLLWLAIGICLLS 1037 >10_08_0058 + 14521922-14522779 Length = 285 Score = 26.2 bits (55), Expect = 7.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 70 NSKPTPTSKPNFGSFTLQKLKKLNYTIRSRSSSMCRC 180 +S TPT+ P FT+ L +L S SS C C Sbjct: 18 SSTTTPTATPPRAQFTVSLLDELGRPGWSYRSSSCTC 54 >04_04_0378 - 24822436-24822521,24822623-24822738,24823010-24823092, 24823772-24823918,24824004-24824051,24824153-24824353, 24824981-24825152,24825235-24825299,24825813-24825939, 24826436-24826528,24826608-24826696,24826804-24826950, 24827047-24827359,24827474-24828048 Length = 753 Score = 26.2 bits (55), Expect = 7.9 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 3 KIIKASGAEADSFET--SISQALVELETNSDLKAQLRELYITKAKEIELHN 149 K +K + E D E ISQAL L + S + + +E KEIEL+N Sbjct: 565 KELKKAKVEHDRKEQLCDISQALAVLASASSVAKERQEFLNLVNKEIELYN 615 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,970,089 Number of Sequences: 37544 Number of extensions: 158264 Number of successful extensions: 390 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 564709324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -