BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1252 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 24 1.4 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 442 TKRNEHFQPRTRRRAESDQRH 504 T+RN +++PRT R ++H Sbjct: 227 TRRNPYYRPRTSRTEPPRRKH 247 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.0 bits (47), Expect = 2.4 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 8/55 (14%) Frame = +2 Query: 365 RPPGGGHTNIFDSEPE--PPRTGRRAVPPSAT------STFSHGQGDEPKATNGT 505 R PGG H+ EPE ++ VP S + + FS GQ + P ++ + Sbjct: 16 RSPGGDHSENMQDEPENLSNKSNSITVPLSISTGQRLPANFSFGQVNSPPSSTSS 70 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 10 PHSACSQKYACV 45 PH +CS Y CV Sbjct: 1214 PHESCSSFYVCV 1225 Score = 21.4 bits (43), Expect = 7.4 Identities = 5/11 (45%), Positives = 6/11 (54%) Frame = -3 Query: 445 WWNGTAAGPRW 413 WW+ T P W Sbjct: 1042 WWSSTTTSPWW 1052 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 5.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 10 PHSACSQKYACVQWK 54 PH C + Y CV K Sbjct: 484 PHELCDKYYRCVHGK 498 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,087 Number of Sequences: 336 Number of extensions: 3513 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -