BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1249 (608 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 25 0.38 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 2.7 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 4.6 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 8.1 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 25.4 bits (53), Expect = 0.38 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 136 GTPWSTAATRGAGAWMMLYSAYEPSPT 216 G WS AAT A A YSA P P+ Sbjct: 105 GLFWSPAATAAATATEYKYSAAAPGPS 131 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = +1 Query: 463 GSVDPPWERAVTPANDLIILTMSWRQRTGDHPKMIELMNFFSPT 594 G D PW+R N ++ +W D K+ + F+ T Sbjct: 223 GGADTPWQREYENVNSTVV---NWVNAGADPGKLTIGLAFYGHT 263 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/57 (21%), Positives = 20/57 (35%) Frame = -1 Query: 491 ARSHGGSTEPARNPWQRRPHRRGPRMPADGPAPPHRRREHRLLYLSHQVSPVTDLVA 321 A + S + + + PH PA PH H + +Q P + +A Sbjct: 102 ANGYNHSPHLSHMQFMQLPHPAAAHSALLSPAMPHNLTRHDGSVIKNQGMPTMEAIA 158 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 509 SLAGVTARSHGGSTEPARNPWQR 441 S AGVTA++ P WQR Sbjct: 206 SWAGVTAQNSPLYASPLDGEWQR 228 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,641 Number of Sequences: 336 Number of extensions: 3020 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -