BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1249 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 33 0.24 SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_53322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_109| Best HMM Match : Spectrin (HMM E-Value=0.002) 30 1.3 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 30 1.7 SB_46405| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_11351| Best HMM Match : LRV (HMM E-Value=6) 29 2.2 SB_31989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_7982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) 29 2.9 SB_57060| Best HMM Match : W2 (HMM E-Value=2.5) 29 3.9 SB_48974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_39482| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_27478| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_15585| Best HMM Match : Collagen (HMM E-Value=2.7e-12) 28 5.1 SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) 28 5.1 SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) 28 5.1 SB_56756| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_46833| Best HMM Match : MGS (HMM E-Value=1.5e-19) 28 6.8 SB_36009| Best HMM Match : Collagen (HMM E-Value=0) 28 6.8 SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) 28 6.8 SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 27 9.0 SB_27208| Best HMM Match : ICAT (HMM E-Value=1.8e-09) 27 9.0 SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 35.9 bits (79), Expect = 0.026 Identities = 17/60 (28%), Positives = 33/60 (55%) Frame = +3 Query: 78 QARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLDELASRVQAAER 257 Q+ E ++ +VA ++ +W+ L +S+ LDDA+ V F N D+ S ++ A++ Sbjct: 3700 QSAEEQDNLDEKVADISRRWDELKSKSNERSSLLDDAISAVAEFQNLRDKFVSWLEEADK 3759 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 32.7 bits (71), Expect = 0.24 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 452 PWQRRPHRRGPRMPADGPAPPHRRREHR 369 P QRR + RGP MP D PP R R R Sbjct: 268 PEQRRDNMRGPGMPPDMHGPPDRGRHDR 295 >SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/65 (26%), Positives = 33/65 (50%) Frame = +3 Query: 72 EEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLDELASRVQAA 251 +E ++ ++ E+A+ + N L +R D W + LDD +QR + + D +VQ + Sbjct: 720 QETTKQEVGHLKTELAQKEELLNKLSERVDYWNKILDD-LQRKQTEIEAADRKIPQVQTS 778 Query: 252 ERPGL 266 + L Sbjct: 779 AQKTL 783 >SB_53322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/35 (25%), Positives = 25/35 (71%) Frame = +3 Query: 90 LARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQ 194 +A +++ ++ ++D+W+ L RS+ W + +D+A++ Sbjct: 44 VAGNLQHQLEVVSDRWSALCQRSEEWQKQVDEALR 78 >SB_109| Best HMM Match : Spectrin (HMM E-Value=0.002) Length = 365 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/35 (25%), Positives = 25/35 (71%) Frame = +3 Query: 90 LARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQ 194 +A +++ ++ ++D+W+ L RS+ W + +D+A++ Sbjct: 44 VAGNLQHQLEVVSDRWSALCQRSEEWQKQVDEALR 78 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -1 Query: 371 RLLYLSHQVSPVTDLVAGFCLSPVSVLERRLVLAMKTWPFSCLDSAGE 228 RL L H+VS +TD+++ F S V L+ AM+ SC DS E Sbjct: 268 RLEDLCHKVSQLTDIMSSFA-SVVKELKTAYDAAMQQNDLSCSDSENE 314 >SB_46405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -1 Query: 497 VTARSHGGSTEPARNPWQRRPHRRGPRMPADGPAPPHRRREHRLLYLSHQVS 342 + AR + A+NP R+ H + + PH R H L Y S VS Sbjct: 24 LAARELDARAKGAKNPRWRQKHGKAGLLSLKHQQTPHSRLHHLLTYFSGNVS 75 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 99 SIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLDELASRVQAAERPGLHGED 278 ++ + LAD W+ L D SD + L +A+Q+ + F ++ EL + ++ E L ED Sbjct: 1868 TVESRLKDLADLWSLLGDLSDNKAQRLKEAIQK-QTFERNVIELQAWIEEVEN-ALASED 1925 >SB_11351| Best HMM Match : LRV (HMM E-Value=6) Length = 194 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 464 PARNPWQRRPHRRGPRMPADGPAPPHR 384 PA N PH GP + ADG PP R Sbjct: 136 PAVNQRATDPHATGPHVAADGVTPPAR 162 >SB_31989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1498 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +3 Query: 12 TSDTEPSRDSEGDSRGYRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAV 191 +SD E S DS+GDS S++E+ + R+ R + D + R + DDA+ Sbjct: 1424 SSDEEKSGDSDGDSGEDDSSDEEKPAVPRATSRLEESIMDNIVSSTPRPRSQAEKNDDAI 1483 Query: 192 Q 194 + Sbjct: 1484 K 1484 >SB_7982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/78 (20%), Positives = 40/78 (51%) Frame = +3 Query: 60 YRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLDELASR 239 Y S+EE+ + S+ R + + + W + + + W + +++Q V+ + + ++ ++ Sbjct: 342 YSSSEEEKKVYGPSLARLSSAVGEAWTAMQNDAYQWLQVDFNSMQNVK-YIATQGKVGTQ 400 Query: 240 VQAAERPGLHGEDQATLK 293 + HG +Q+TLK Sbjct: 401 ERVKSYNLKHGNEQSTLK 418 >SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) Length = 1426 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +3 Query: 18 DTEPSRDSEGDSRGYRSAEE---QARELARSIRREVAKLADKWNTLVDRSDAWGR-CLDD 185 +T PS SEGD+R R+ + + I++E+ +L +W T +D S W ++D Sbjct: 882 ETRPSSRSEGDTRDRRTPRQGLAHNEDDKNEIQKEMDELQHRW-TELDESLHWKEDRIED 940 Query: 186 AVQRV 200 V+++ Sbjct: 941 TVRKL 945 >SB_57060| Best HMM Match : W2 (HMM E-Value=2.5) Length = 152 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/28 (32%), Positives = 21/28 (75%) Frame = +3 Query: 63 RSAEEQARELARSIRREVAKLADKWNTL 146 R+ + +A++ A S+R+++AK ++W+ L Sbjct: 125 RTTKPKAKKSAESVRKQIAKTIERWDDL 152 >SB_48974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/28 (32%), Positives = 21/28 (75%) Frame = +3 Query: 63 RSAEEQARELARSIRREVAKLADKWNTL 146 R+ + +A++ A S+R+++AK ++W+ L Sbjct: 125 RTTKPKAKKSAESVRKQIAKTIERWDDL 152 >SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = +3 Query: 216 SLDELASRVQAAERPGLHGEDQ---ATLKHRHWRETKSSYQ--ISYWRNLMT*IQESVLS 380 SL+EL SR++ E G++G+D AT H + S++ I ++L + E V+ Sbjct: 118 SLEELKSRIEILEASGINGQDSLNIATAIPSHLDFSAHSFKDIIEILQDLKCNVAEIVIK 177 Query: 381 AP 386 AP Sbjct: 178 AP 179 >SB_39482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/28 (32%), Positives = 21/28 (75%) Frame = +3 Query: 63 RSAEEQARELARSIRREVAKLADKWNTL 146 R+ + +A++ A S+R+++AK ++W+ L Sbjct: 125 RTTKPKAKKSAESVRKQIAKTIERWDDL 152 >SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2147 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/66 (33%), Positives = 29/66 (43%) Frame = +1 Query: 151 TAATRGAGAWMMLYSAYEPSPTLLTSSPAESKQLNGQVFMARTRRRSSTDTGERQNPATR 330 T+AT+ + + + EP T +TS E QV A RSS T QNP + Sbjct: 917 TSATQESPSSQVTSVTQEPPSTQVTSVTQEPPST--QVTSATQESRSSQVTSVTQNPPSS 974 Query: 331 SVTGET 348 VT T Sbjct: 975 QVTSVT 980 >SB_6848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 223 TSSPAESKQLNGQVFMARTRRRSSTDTGERQNPATRSVTGE 345 T S + LNG + A TR ST Q+P RSVT E Sbjct: 29 TRSGKSTPALNGSFYDA-TRSERSTPISRSQSPGMRSVTSE 68 >SB_27478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 484 PTVGPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 PT GP+ G G GPT TGP PTG Sbjct: 26 PT-GPKGDTGATGPTGPTGPKGDTGATGPTGPTG 58 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 484 PTVGPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 PT GP+ G G GPT TGP PTG Sbjct: 146 PT-GPKGDTGATGPTGPTGPKGDTGATGPAGPTG 178 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 484 PTVGPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 PT GP +G G+ GPT TGP PTG Sbjct: 251 PT-GPTGPKGDTGATGPTGPKGDTGATGPAGPTG 283 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 475 GPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 GP +G G+ GPT TGP PTG Sbjct: 13 GPTGPKGDTGATGPTGPKGDTGATGPTGPTG 43 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 475 GPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 GP +G G+ GPT TGP PTG Sbjct: 133 GPTGPKGDTGATGPTGPKGDTGATGPTGPTG 163 >SB_15585| Best HMM Match : Collagen (HMM E-Value=2.7e-12) Length = 104 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 484 PTVGPRNQRGTPGSAGPTVAGHACQLTGPLLPTG 383 PT GP +G G+ GPT TGP PTG Sbjct: 32 PT-GPTGPKGDTGATGPTGPKGDTGATGPAGPTG 64 >SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) Length = 1354 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 216 SLDELASRVQAAERPGLHGEDQATLKHRHWRE 311 SLD++ S V +PG+ G+ LK H++E Sbjct: 516 SLDDIISDVAIFRKPGVTGKGLYELKEEHYKE 547 >SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) Length = 1328 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 423 PATVGPALPGVPRWFRGPTVGTSRHASQRPYYINHELETTHWGPSEDD*TNELL 584 P++ G LP + R G + + YYI++ ++T H P ED + +L Sbjct: 110 PSSAGAELPPLER--TGSPTAAEKDILRYYYYIHNGIDTEHVAPMEDSWLDHVL 161 >SB_56756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/57 (28%), Positives = 23/57 (40%) Frame = +3 Query: 6 SDTSDTEPSRDSEGDSRGYRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRC 176 +D S T R E R S E+Q + K+ K N +DR++ W C Sbjct: 38 TDLSITLEKRTREPSERTINSCEKQEHLKSEKAPLPELKIRPKHNESLDRANVWSVC 94 >SB_46833| Best HMM Match : MGS (HMM E-Value=1.5e-19) Length = 648 Score = 27.9 bits (59), Expect = 6.8 Identities = 20/94 (21%), Positives = 37/94 (39%) Frame = +3 Query: 60 YRSAEEQARELARSIRREVAKLADKWNTLVDRSDAWGRCLDDAVQRVRAFTNSLDELASR 239 Y+ AE+Q +EL S+ + +L + WN + D +C V ++ A + D L+ Sbjct: 362 YKKAEQQVQELVESLILKRQRLRELWNIRKQKLD---QCFQFRVFQIDAHKSYPDTLSRE 418 Query: 240 VQAAERPGLHGEDQATLKHRHWRETKSSYQISYW 341 + L G + + S+W Sbjct: 419 QGLKDYTLLSGSRSCDISNLEKHNFHEDATPSFW 452 >SB_36009| Best HMM Match : Collagen (HMM E-Value=0) Length = 687 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -2 Query: 481 TVGPRNQRGTPGSAG-PTVAGHACQLTGPLLPTGAE 377 T GP RG PG+ G P AG A GP P GAE Sbjct: 176 TAGPPGVRGQPGAIGSPGDAGRA----GPQGPQGAE 207 >SB_52974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = -1 Query: 554 WSPVRCLQLMVNIIRSLAGVTARSH----GGSTEPARNPWQRRPHRRGPRMPADGPAPPH 387 WSP + + ++ SL G+ R + PA N PH P + ADG PP Sbjct: 394 WSPSSVIGV-AGLLVSLFGLYTRRRELAAAFTRTPAVNQRATDPHATDPHVAADGVTPPA 452 Query: 386 R 384 R Sbjct: 453 R 453 >SB_14341| Best HMM Match : DUF1339 (HMM E-Value=4.4) Length = 801 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +3 Query: 387 VGRSGPVSWHAWPATVGPALPGVPR----WFRGPTVGTSRHA 500 + R GP HA A +G P +PR W GP G SR A Sbjct: 147 IPRDGPPPTHADLADLGRGYPRLPRLGPVWASGPRRGWSRGA 188 >SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 276 PRHEDLAVQLLGLCWRARQESW*RLVRAVQHHPSTCPT 163 P DLAV+ +G C R ES +V + P+ CPT Sbjct: 571 PEGRDLAVRFVGKCPRHGDES--SIVVRDREEPARCPT 606 >SB_24945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 545 VRCLQLMVNIIRSL--AGVTARSHGGSTEPARNPWQRRPHRRGPRMPADGPAPPHRRREH 372 + C++L+ + I + G S E A+N + P + G PP RREH Sbjct: 23 IHCMRLLTSEINRVQSGGTLVMSPMSEDEKAKNGEKGEGSEEDPLVEG-GQRPPRERREH 81 Query: 371 R 369 R Sbjct: 82 R 82 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 512 RSLAGVTARSHGGSTEPARNPW 447 +SLA VTA HG +T A +PW Sbjct: 1056 QSLAKVTATFHGLATHAAASPW 1077 >SB_27208| Best HMM Match : ICAT (HMM E-Value=1.8e-09) Length = 569 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 51 SRGYRSAEEQARELARSIRREVAKLADKWNTLVD-RSDAWGRCLDDAVQRVRAFTNSLDE 227 SRG + + L + R VA+LAD D D + + V++++ F SLD+ Sbjct: 3 SRGKSETHKLQQNLEEQLDRLVAQLADLEECRADLDDDEYEETKKETVEQLKEFKESLDK 62 Query: 228 L 230 + Sbjct: 63 I 63 >SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 464 PARNPWQRRPHRRGPRMPADGPAPPHR 384 PA N PH GP + AD PP R Sbjct: 881 PAVNQRATNPHATGPHVAADDVTPPTR 907 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,293,344 Number of Sequences: 59808 Number of extensions: 463629 Number of successful extensions: 2158 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2129 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -